KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_1713Help
Entry
LEUM_1713         CDS       T00411                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lme00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1684173..1684769)
Genome map
AA seq 198 aa AA seqDB search
MTQRGLLIVLSGPSGVGKGTVRKAIFEEESIDFQYSISATTRQPRAGEVDGEDYFFVTRE
QFEEKINNGDMLEYAKYVSNYYGTPKSFIDETLASGRDVFLEIDVQGALQVKSKMPEGIY
IFLTLPDLANLRDRLVGRGTDSADVIEKRVAAARDELKMMINYDYAVENDVVSNAVERIK
SIITAERLRVTRVFDKIQ
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgactcagcgtggtttattaatcgtactttcaggaccctcaggtgtcggaaaaggcact
gtacgtaaagcaatttttgaagaagaaagcattgattttcaatattcgatttccgctaca
acacgtcagccccgtgctggagaagtagacggtgaagattatttctttgtaacccgtgaa
cagtttgaagaaaaaattaataatggtgacatgttagagtatgcaaaatatgtcagcaac
tattacggaacacctaaaagctttatagacgagacgttggcgagcgggcgtgatgttttt
ttggaaatagacgtacaaggtgccttgcaagttaaatcaaaaatgccagaaggtatttac
atatttttgacacttccggatttggcaaatctacgcgaccgtttggtcggtcgtggtaca
gattctgctgatgtgattgaaaaacgagttgcagcggcgcgtgacgaacttaaaatgatg
attaattacgattatgctgttgaaaacgatgtggtttcaaacgcagttgaacgaatcaaa
tcaatcattacagcagaacgcctacgcgtaacgcgtgtatttgataagatacaataa

DBGET integrated database retrieval system