KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_1785Help
Entry
LEUM_1785         CDS       T00411                                 

Definition
(RefSeq) thymidine kinase (EC:2.7.1.21)
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LEUM_1785
Enzymes [BR:lme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LEUM_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1755854..1756489)
Genome map
AA seq 211 aa AA seqDB search
MFSIARKHSKNMAQLFFEYGAMSSGKSIEILKVAHNYESQGRKVLLMTPIMDTRAGVGVV
ASRIGLSREAVAVQPEDDLYHLIKGMKDDHLAVVLIDEAQFLAAKQVDQLAYVVDHLNIP
VMTFGLKQDAFNHLFEGSKRLIELADKLEEMKTICSFCGKKATTQLRIVDGKPQREGAQV
FIGGDEAYIPTCRHHWFKPDLDKITEMFPVK
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtgttttcgattgctcgtaagcacagtaaaaatatggcacaattattctttgaatatggc
gcaatgagttccggaaagtctattgaaattcttaaggttgcgcataattatgaatcacaa
gggcgcaaggtgttgctgatgacaccaattatggatacaagagctggtgttggcgtcgtt
gctagtcgcatcggtctttctagagaggctgtggcagtccaaccagaagatgatctatac
catttgatcaagggcatgaaagatgatcatttagcagtagttttgattgatgaagcacag
tttctcgctgctaaacaagttgatcagctagcttatgtggttgaccacttgaacattccg
gtaatgacttttgggttgaagcaagatgccttcaaccatttattcgaaggatcaaaacgt
ttaatagagctggctgacaagttagaggaaatgaaaaccatttgctcattttgcggtaaa
aaagcgacaacgcaattgcgtattgttgatgggaagccacaacgggaaggtgcgcaagtt
tttattggcggggatgaagcctatattcctacatgtcgtcatcattggtttaagcctgat
ttagataaaataactgagatgtttccggttaaataa

DBGET integrated database retrieval system