KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_1788Help
Entry
LEUM_1788         CDS       T00411                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    LEUM_1788
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LEUM_1788
Enzymes [BR:lme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     LEUM_1788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1758554..1759912
Genome map
AA seq 452 aa AA seqDB search
MTVKSSIARVTAKTSYWFLRNILHRGGTSLPGKLAVSIDPDILKTIQQDFDLIIVTGTNG
KTLTTALITRVLQAGGYQVITNPSGSNMIQGITGTLVTTKVKKSPNGKKPLAVLEVDEAN
VEKITAAIQPKMFVLTNIFRDQMDRYGEIYTTYEKIVTGIKNAPEALVLANGDSPIFTRG
NFTNTRRYFGFDHVVPADYNPDVAPINTDGILSPTDNSVLHYDFITYANLGKYFSTTDKF
SRPKLNYRITGVDHLTPRYSTFSIDNTPLRIEIGGLYNIYNALAAFSVGREFGVTPEQIK
KAFESNAQIFGRQEAIDVDGKDVIIVLIKNPVGTNSVIDMMLTEKDEFSLLALLNANYAD
GIDTSWIWDAEFEKLHDTKIQAVATGGERYKDLRVRLKMAGFTDQAVYEDLSEVVTAIKS
LPTKKVYIAATYTAMLQLREQLSAKGYIKGGF
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgacagttaaaagttcaattgcacgcgtcacagcaaaaacttcgtactggtttttacga
aatattttacatcgtggtggaaccagtttacccggtaaactagctgtttcgattgatcct
gacattttaaaaacaattcaacaagattttgatttgatcattgtcactggaaccaacgga
aaaacactcacgaccgccttgattactcgtgtcttacaagctggtggctatcaagtcatc
accaacccttctgggtcaaacatgattcaaggtattaccggaactttagtgacaaccaaa
gtaaaaaaatcacctaacggtaaaaagccactagccgtactcgaagttgatgaagctaat
gttgaaaaaatcacggcagcaatccaaccaaaaatgtttgtactaaccaatattttccgt
gatcagatggatcgctatggtgaaatttacacaacttacgaaaaaattgttactggaatt
aagaatgcacctgaagcgcttgtcctagccaatggcgattcacctatatttactcgcggt
aatttcaccaacacgcgtcgttattttggttttgatcacgttgtgccagcagattataat
cctgatgttgcaccaattaacactgatggtattttgtcaccaaccgataattctgtactc
cactatgattttattacttatgctaatttgggaaaatattttagtacaacagacaagttt
tcgcgccccaagttaaattatcgcatcactggtgtggatcatttaacaccacgatactca
acttttagcattgacaacacaccattgcgcattgaaattggtggcttatataatatctac
aacgccctagcagctttctcagtcggacgagaatttggtgtgactcctgaacaaatcaaa
aaggcatttgaatcaaatgctcaaatttttgggcgtcaagaagccattgatgttgacggt
aaagatgtgatcatcgttttgattaagaaccccgtcggtactaattcagtaatcgacatg
atgctcaccgaaaaagatgaattctctcttttggcgctgttaaatgcaaattacgcagat
ggcattgatactagttggatttgggatgctgaatttgagaaattacatgatacaaaaata
caagccgtagccactggtggcgaacgttataaagatttacgcgtgcgtttaaagatggct
ggttttacagaccaagccgtttatgaagatctctcagaagtcgtgacggctatcaagtca
ctgccaacaaaaaaagtttatattgctgctacttatacggcaatgctgcaattgcgcgaa
caattaagcgctaagggctacatcaaaggaggtttctaa

DBGET integrated database retrieval system