KEGG   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293: LEUM_1919Help
Entry
LEUM_1919         CDS       T00411                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lme  Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
Pathway
lme00010  Glycolysis / Gluconeogenesis
lme00350  Tyrosine metabolism
lme00625  Chloroalkane and chloroalkene degradation
lme00626  Naphthalene degradation
lme01100  Metabolic pathways
lme01110  Biosynthesis of secondary metabolites
lme01120  Microbial metabolism in diverse environments
lme01130  Biosynthesis of antibiotics
lme01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEUM_1919
  Lipid metabolism
   00071 Fatty acid degradation
    LEUM_1919
  Amino acid metabolism
   00350 Tyrosine metabolism
    LEUM_1919
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LEUM_1919
   00626 Naphthalene degradation
    LEUM_1919
Enzymes [BR:lme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LEUM_1919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ABJ62992
JGI: LEUM1919
UniProt: Q03UY0
Position
complement(1887402..1888454)
Genome map
AA seq 350 aa AA seqDB search
MKAAVVRNVNDGYVDLIEDWQPRALAFGDALVDVEYVGLCHTDLHCANGDFGDPNKIGER
NGNFGRVIGHEGVGRVSKLGEGASDYLKVGDRVSIAWFYDACGVCDYCVSGNETFCRKVR
NSGYTIDGAMSQQVVVNAKYAVKVPEGLDPVEATSITCAGVTMYKALKVGETKPGEWVSV
HGAGGLGNLAVQYAHSVFGAHVAVIDGNDDKLAAAKANGAEVLVNRKKEDVVAKVNELTG
GVHNAQVTAVNDAAFSQAVNVLRPMGKLVAVALPQGDMALNIAKTVLDGIEVRGSLVGTR
ADLKEAFQFGAEGKVKPIVETVAFQDMNEIIDEMKAGSITGRKVIDFTTL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagttgttcgtaacgtaaatgatggttatgttgatttgatcgaggattgg
cagccacgtgcgttagcatttggagatgcattggttgatgttgaatacgttggcctttgt
cacactgatttgcactgtgctaacggcgatttcggtgaccctaacaagatcggtgaacgt
aacggtaattttggtcgagttattggacatgaaggtgttggacgcgtgtctaaattaggt
gaaggtgctagcgattaccttaaagtcggtgaccgtgtttcaattgcctggttctatgac
gcttgtggcgtttgtgattactgtgtctcaggaaacgaaacgttctgccgtaaggtgcgt
aattctggttacacaattgatggcgcaatgtcacaacaagttgttgtaaatgctaagtat
gcagttaaagtaccagaaggcttagaccctgttgaagcgacatcaattacttgtgctggt
gttacaatgtacaaagccttgaaagtcggtgaaactaagcctggtgagtgggtgtcagtt
cacggtgctggtggtctaggtaatttggctgttcaatatgcacacagtgttttcggtgct
cacgttgcagttattgatggaaacgatgataaattagcagccgcaaaagctaatggagcg
gaagtactagttaatcgtaagaaggaagatgttgtagctaaggtgaatgaattaactggc
ggcgttcacaatgctcaagtgacagctgttaacgatgctgcattctcccaggctgtgaat
gtgcttcgtccaatgggcaagcttgtagccgttgctttgccacaaggtgatatggctttg
aatattgctaaaacagtccttgatggtattgaagttcgcggttcattggttggaacacgt
gcagacctaaaggaagctttccaatttggtgctgaaggaaaagttaagccaattgttgag
acagttgccttccaagatatgaatgaaattattgatgaaatgaaagctggttcaattact
ggtcgtaaggtcattgattttacaacactttaa

DBGET integrated database retrieval system