KEGG   Listeria monocytogenes F2365: LMOf2365_0201Help
Entry
LMOf2365_0201     CDS       T00174                                 

Gene name
ispE
Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase activity
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lmf  Listeria monocytogenes F2365
Pathway
lmf00900  Terpenoid backbone biosynthesis
lmf01100  Metabolic pathways
lmf01110  Biosynthesis of secondary metabolites
lmf01130  Biosynthesis of antibiotics
Module
lmf_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:lmf00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMOf2365_0201 (ispE)
Enzymes [BR:lmf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LMOf2365_0201 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AAT02988
UniProt: Q724M3
Position
199346..200227
Genome map
AA seq 293 aa AA seqDB search
MKISITAPAKINLSLDALYKREDGYHEVEMVMTTIDLADRLYLERLDEDKIVLDVKAHFI
PEDRRNLIYQAALLLKKRFDVKMGVRITIDKHIPVSAGLAGGSSDAAAALKGLNVIWELG
LSIEELAEISSEIGSDIAFCVYGGTALATGRGEKISALPNIPGCWIVLAKPSISVSTPTI
YKELQVDNVEHPDTQKMIESIKNGDLDGIFASTGNVLESVTLEKNPQVKRIKDRMLAFGA
EAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRPWSEGENDTNINN
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagcattacagcaccagctaaaattaatctttcacttgatgcgctgtacaaa
cgtgaggacggctatcatgaagtggaaatggtgatgacaacaatcgaccttgctgataga
ttatacttagaacgcttagacgaagacaaaattgtgctggatgtaaaggcacactttatt
ccagaagatcgtcgcaatttaatttatcaagcagccctccttttaaagaagcgttttgac
gtaaagatgggtgtgcgcattacaattgataagcacattcctgtttctgcgggtcttgct
ggtggtagttcagatgcagctgcagcgctcaaaggattaaatgtcatttgggaacttggt
ctttcaatagaagaattagccgaaattagttcggaaattggttctgatatcgctttttgc
gtatacggcggaacagcgctagcaactgggcgcggggaaaagatttctgcgttacctaat
attcctggttgttggattgtgcttgctaaaccgagcattagcgtgtctaccccgactatc
tataaagaacttcaagtagataacgtagaacacccagacacacaaaaaatgattgaatcc
attaaaaatggcgatttagacgggatatttgcgtctacaggaaatgtattagagtctgtg
acattagaaaaaaatccgcaagttaaacgaataaaagatcggatgttagcgtttggtgct
gaggcggccctaatgagtggtagcggtccgacagtgtttgcgcttatcaaacagtactcc
agagcaaaacgtgtctataacggcttgcgtggcttttgtgaggaagtttatatggttaga
ccatggagtgaaggcgagaacgatacaaatataaataattaa

DBGET integrated database retrieval system