KEGG   Listeria monocytogenes F2365: LMOf2365_0201Help
Entry
LMOf2365_0201     CDS       T00174                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lmf  Listeria monocytogenes F2365
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:lmf00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
199346..200227
Genome map
AA seq 293 aa AA seqDB search
MKISITAPAKINLSLDALYKREDGYHEVEMVMTTIDLADRLYLERLDEDKIVLDVKAHFI
PEDRRNLIYQAALLLKKRFDVKMGVRITIDKHIPVSAGLAGGSSDAAAALKGLNVIWELG
LSIEELAEISSEIGSDIAFCVYGGTALATGRGEKISALPNIPGCWIVLAKPSISVSTPTI
YKELQVDNVEHPDTQKMIESIKNGDLDGIFASTGNVLESVTLEKNPQVKRIKDRMLAFGA
EAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRPWSEGENDTNINN
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagcattacagcaccagctaaaattaatctttcacttgatgcgctgtacaaa
cgtgaggacggctatcatgaagtggaaatggtgatgacaacaatcgaccttgctgataga
ttatacttagaacgcttagacgaagacaaaattgtgctggatgtaaaggcacactttatt
ccagaagatcgtcgcaatttaatttatcaagcagccctccttttaaagaagcgttttgac
gtaaagatgggtgtgcgcattacaattgataagcacattcctgtttctgcgggtcttgct
ggtggtagttcagatgcagctgcagcgctcaaaggattaaatgtcatttgggaacttggt
ctttcaatagaagaattagccgaaattagttcggaaattggttctgatatcgctttttgc
gtatacggcggaacagcgctagcaactgggcgcggggaaaagatttctgcgttacctaat
attcctggttgttggattgtgcttgctaaaccgagcattagcgtgtctaccccgactatc
tataaagaacttcaagtagataacgtagaacacccagacacacaaaaaatgattgaatcc
attaaaaatggcgatttagacgggatatttgcgtctacaggaaatgtattagagtctgtg
acattagaaaaaaatccgcaagttaaacgaataaaagatcggatgttagcgtttggtgct
gaggcggccctaatgagtggtagcggtccgacagtgtttgcgcttatcaaacagtactcc
agagcaaaacgtgtctataacggcttgcgtggcttttgtgaggaagtttatatggttaga
ccatggagtgaaggcgagaacgatacaaatataaataattaa

DBGET integrated database retrieval system