KEGG   Listeria monocytogenes F2365: LMOf2365_0236Help
Entry
LMOf2365_0236     CDS       T00174                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lmf  Listeria monocytogenes F2365
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lmf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
237674..238741
Genome map
AA seq 355 aa AA seqDB search
MKRKTEKSHETLTKITAYPPKTWLIYSHKLTTSKTFSFFSPLFRMKIPNSLFDRCGLLPF
PHRFFCALKSLNSAIINLGKRCLGLKKWKRDHLGMVMGILNVTPDSFSDGGKYMQVEEAV
ARALQMAEDGAAIIDVGGISTRPGFSEVTPEEELNRIIPVIKAVRTKLPDIWISVDTWRA
EVAEKAILAGANMINDQWGAKKEPKIAEVAAKYNVPICLMHNRENTQYDNFLEDVKKDLL
ESVAIAKAASVPDEHIILDPGFGFVKTPAQNLEVLRRIDEIVALGYEVLLGTSRKSTIGL
VLGTTPEDRMEGTGATTVYGFSKGCTITRVHDVLPIARMVRMTDAITGKLDITKL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaaaaccgaaaaatctcatgaaactttaacaaaaatcacagcatatccacca
aaaacttggttaatatatagtcataagctaacaacaagcaaaacattttcattcttctcc
cccctttttagaatgaagatcccaaactccctttttgaccgatgcggtttactccctttt
ccgcatcggtttttttgtgcgctaaaatcactgaattctgctataataaatctcggaaag
aggtgtttgggcttgaagaagtggaaaagggatcacttaggtatggtcatggggatactg
aatgttacgccagactctttttcggatggcgggaaatatatgcaagtggaagaagctgtg
gctcgagcgttacaaatggcagaagatggagcagcaattattgacgttggtggaatatct
actcggcctggtttttcagaggtaacgcctgaggaagaacttaatcgaattattcctgtc
attaaagctgttaggacaaaacttccggatatatggatttctgttgatacttggcgtgcc
gaagtggctgaaaaagctattttagcaggagctaatatgataaatgatcaatggggtgcc
aaaaaagaaccgaaaattgcggaagtagctgcgaaatataacgtgccaatttgtttgatg
cacaaccgagaaaacacgcaatacgataattttctggaagatgtgaagaaagacttatta
gaaagtgttgcaattgctaaagcggcatccgtgccagatgaacatattattcttgatccg
ggtttcggttttgttaagacacctgcgcagaatttagaagtgttacgacgcattgatgag
atagtggcgcttggttacgaggttttacttggtacgagtagaaagtcgacaattggtctc
gtcttaggaactactccagaggatagaatggaaggaactggagcaactacagtttacgga
ttttcgaaaggttgcacaattactcgtgtacacgatgtacttcccattgcgcgcatggta
cgaatgacagatgcgattactggcaaattagatattacaaaattataa

DBGET integrated database retrieval system