KEGG   Listeria monocytogenes F2365: LMOf2365_0284Help
Entry
LMOf2365_0284     CDS       T00174                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lmf  Listeria monocytogenes F2365
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lmf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LMOf2365_0284
  Amino acid metabolism
   00300 Lysine biosynthesis
    LMOf2365_0284
Enzymes [BR:lmf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LMOf2365_0284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
Position
303126..304265
Genome map
AA seq 379 aa AA seqDB search
MERQRKIQILKDIVNIDSTNGHEEQVANYLQKLLAEHGIESEKVKYDVDRASLVSEIGSS
DEKVLAFSGHMDVVDAGDVSKWKFPPFEATEHEGKIYGRGATDMKSGLAAMIIAMIELHE
EKQKLNGKIRLLATVGEEVGELGAEQLTQKGYADDLDGLIIGEPSGHRIVYAHKGSINYT
VKSTGKNAHSSMPEFGVNAIDNLLLFYNEVEKFVKSIDATNEILGDFIHNVTVIDGGNQV
NSIPEKAQLQGNIRSIPEMDNETVKQVLVKIINKLNKQENMNLELIFDYDKQPVFSDKNS
DLVHIAKSVASDIVKEEIPLLGISGTTDAAEFTKAKKEFPVIIFGPGNETPHQVNENVSI
ENYLEMVDVYKRIATEFLS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggaacgacaaagaaaaattcaaatcttaaaagacattgtgaatattgattcgactaat
gggcatgaagaacaagttgcgaactatttgcaaaagttgttagctgaacacggtattgag
tccgaaaaggtaaaatacgacgtagacagagccagcctagttagcgaaattggttccagt
gacgagaaagttttggcgttttcagggcatatggatgtcgttgatgcgggtgatgtctcg
aagtggaagttcccaccttttgaagcaacagagcatgaagggaaaatatacggacgtggc
gcgacggatatgaagtcaggtctagcggcgatgattattgcaatgattgagcttcatgaa
gaaaaacaaaaactaaatggcaaaattagattattagcaacggttggtgaagaagtcggt
gaacttggagccgaacaactaacgcaaaaaggttacgcagatgatttagatggcttgatt
atcggcgaaccgagtggacaccggattgtttatgcgcataaaggttccattaattatacc
gttaaatccactggtaaaaatgcgcatagttcgatgccggaatttggtgttaatgcgatt
gacaacttgttgctattttataatgaagtagaaaaattcgtgaaatcaattgatgctact
aacgaaatattaggcgattttattcataatgtcaccgtaattgatggtggaaatcaagtc
aatagtatccctgaaaaagcgcaactacaagggaatattcgctcgattccagaaatggat
aacgaaacagtgaaacaagtgctagtgaagattatcaataagttaaataaacaggaaaat
atgaatctagaattaatatttgattatgacaaacaaccagtatttagtgataaaaattcg
gatttagtccacattgctaagagcgtagcaagcgacattgtcaaagaagaaatcccatta
ctcggtatttccggaacaaccgatgcagcagaatttaccaaagctaagaaagagttccca
gtgattatttttggaccaggaaacgaaacccctcaccaagtaaacgaaaatgtttctata
gagaattatttggagatggtagatgtttacaaacgaattgccaccgagtttttatcgtga

DBGET integrated database retrieval system