KEGG   Listeria monocytogenes F2365: LMOf2365_0284Help
Entry
LMOf2365_0284     CDS       T00174                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lmf  Listeria monocytogenes F2365
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lmf01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:lmf00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
Position
303126..304265
Genome map
AA seq 379 aa AA seqDB search
MERQRKIQILKDIVNIDSTNGHEEQVANYLQKLLAEHGIESEKVKYDVDRASLVSEIGSS
DEKVLAFSGHMDVVDAGDVSKWKFPPFEATEHEGKIYGRGATDMKSGLAAMIIAMIELHE
EKQKLNGKIRLLATVGEEVGELGAEQLTQKGYADDLDGLIIGEPSGHRIVYAHKGSINYT
VKSTGKNAHSSMPEFGVNAIDNLLLFYNEVEKFVKSIDATNEILGDFIHNVTVIDGGNQV
NSIPEKAQLQGNIRSIPEMDNETVKQVLVKIINKLNKQENMNLELIFDYDKQPVFSDKNS
DLVHIAKSVASDIVKEEIPLLGISGTTDAAEFTKAKKEFPVIIFGPGNETPHQVNENVSI
ENYLEMVDVYKRIATEFLS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggaacgacaaagaaaaattcaaatcttaaaagacattgtgaatattgattcgactaat
gggcatgaagaacaagttgcgaactatttgcaaaagttgttagctgaacacggtattgag
tccgaaaaggtaaaatacgacgtagacagagccagcctagttagcgaaattggttccagt
gacgagaaagttttggcgttttcagggcatatggatgtcgttgatgcgggtgatgtctcg
aagtggaagttcccaccttttgaagcaacagagcatgaagggaaaatatacggacgtggc
gcgacggatatgaagtcaggtctagcggcgatgattattgcaatgattgagcttcatgaa
gaaaaacaaaaactaaatggcaaaattagattattagcaacggttggtgaagaagtcggt
gaacttggagccgaacaactaacgcaaaaaggttacgcagatgatttagatggcttgatt
atcggcgaaccgagtggacaccggattgtttatgcgcataaaggttccattaattatacc
gttaaatccactggtaaaaatgcgcatagttcgatgccggaatttggtgttaatgcgatt
gacaacttgttgctattttataatgaagtagaaaaattcgtgaaatcaattgatgctact
aacgaaatattaggcgattttattcataatgtcaccgtaattgatggtggaaatcaagtc
aatagtatccctgaaaaagcgcaactacaagggaatattcgctcgattccagaaatggat
aacgaaacagtgaaacaagtgctagtgaagattatcaataagttaaataaacaggaaaat
atgaatctagaattaatatttgattatgacaaacaaccagtatttagtgataaaaattcg
gatttagtccacattgctaagagcgtagcaagcgacattgtcaaagaagaaatcccatta
ctcggtatttccggaacaaccgatgcagcagaatttaccaaagctaagaaagagttccca
gtgattatttttggaccaggaaacgaaacccctcaccaagtaaacgaaaatgtttctata
gagaattatttggagatggtagatgtttacaaacgaattgccaccgagtttttatcgtga

DBGET integrated database retrieval system