KEGG   Listeria monocytogenes F2365: LMOf2365_0291Help
Entry
LMOf2365_0291     CDS       T00174                                 

Definition
glycosyl hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmf  Listeria monocytogenes F2365
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lmf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOf2365_0291
Enzymes [BR:lmf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LMOf2365_0291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(310346..311782)
Genome map
AA seq 478 aa AA seqDB search
MEHQKRSPFPKDFLWGSASAAYQIEGAWDADGKGKSVWDEYVRIPGTTFKGTNGDVAVDH
YHRYKEDVKLMADAGLKAYRFSIAWTRIFPNGKGEVNEAGLKFYDNLIDELLKYDIEPLV
TLYHWDIPQALFDEYGGWESRQVIEDFTNYSTTLFKRYGDRVKYWVSLNEQNIFVGMGYG
QALHPPKVSDPKRMYAVNHIANLANASVIKAFHEIVPDGKIGPSFAYTPHYPIDTDPKNV
QAADDAEELNSYFWMDMYAFGRYPKAVWKYLEENDIAPVIEDGDMELLSSAKPDFMGVNY
YQSATVAYNPLDGVGQNNEMNFTGKKGSTKETGVPGVYKKVVNPFVKTTNWDWTIDPKGL
QIALRRINSRYALPILITENGLGEFDKLVDGEVNDDYRIDYLSAHATAIRDAISDGVDML
GYCTWSFTDLLSWLNGYQKRYGFVYVDRDVEDDAPMTRIPKKSYYWYKQVIETNGADL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaacatcaaaaacgttcaccattcccgaaagatttcttatggggttctgcatcggca
gcttatcaaatcgaaggcgcatgggacgcagacggcaaaggtaaatcagtttgggacgaa
tatgtccgcattcctggaactactttcaaaggtacaaatggcgatgtagctgtcgaccat
tatcaccgttataaagaagacgtaaaactaatggcagacgctggcctaaaagcttaccgt
ttctctatcgcttggactcgtatttttccaaatggtaaaggcgaagtgaatgaagctgga
ttgaaattttatgataacttgattgatgagttgcttaaatatgacattgaaccgcttgta
acgctttatcactgggatatcccacaagcattatttgatgaatacggtggctgggaatct
cgccaagttattgaagatttcacaaattattccacaacgctattcaaacgttacggcgac
cgcgtgaaatattgggtttccttgaatgagcaaaatatctttgttggtatgggttatggt
caagcgcttcacccgccaaaagttagcgatccaaaaagaatgtacgcagtaaaccacatt
gcgaacttagctaatgcgagtgttatcaaagctttccacgaaatcgttcctgatggaaaa
attggaccaagttttgcttacacaccacattatccaatcgacacagatcctaaaaacgtt
caagctgccgacgatgcagaagaattaaacagttatttctggatggatatgtatgctttt
gggcgctatccgaaagcggtttggaaatatttagaagaaaacgatattgcgccagttatt
gaagacggcgatatggaacttctttcttctgcaaaaccagatttcatgggcgtaaactat
taccaatccgcaactgttgcttacaacccgcttgatggcgttggtcaaaacaacgaaatg
aacttcactggtaaaaaaggtagcacgaaagaaactggtgtccctggcgtttacaaaaaa
gtcgttaatccttttgtgaaaacaacgaactgggactggacaatcgatccaaaaggctta
caaattgcgcttcgtcgtattaacagccgctatgctttaccaattttaattacagaaaac
ggtttaggtgaatttgataaattagtggacggagaagtaaacgatgactaccgtattgac
tatctaagcgcgcacgcaactgctattcgcgatgcaatcagtgatggtgttgatatgtta
ggctattgtacttggagcttcacagaccttctaagctggttaaacggctatcaaaaacgt
tacggttttgtttatgttgaccgcgatgtggaagatgatgcgccaatgacacgtattccg
aagaaaagttattattggtataaacaagtgattgaaactaatggagcagatttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system