KEGG   Listeria monocytogenes F2365: LMOf2365_0366Help
Entry
LMOf2365_0366     CDS       T00174                                 

Gene name
tpiA-1
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmf  Listeria monocytogenes F2365
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMOf2365_0366 (tpiA-1)
   01230 Biosynthesis of amino acids
    LMOf2365_0366 (tpiA-1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOf2365_0366 (tpiA-1)
   00051 Fructose and mannose metabolism
    LMOf2365_0366 (tpiA-1)
   00562 Inositol phosphate metabolism
    LMOf2365_0366 (tpiA-1)
Enzymes [BR:lmf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMOf2365_0366 (tpiA-1)
Exosome [BR:lmf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMOf2365_0366 (tpiA-1)
  Exosomal proteins of bladder cancer cells
   LMOf2365_0366 (tpiA-1)
  Exosomal proteins of melanoma cells
   LMOf2365_0366 (tpiA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
Position
complement(390421..391185)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAQTSEWLEATIPLLKNFSDVDTFIFPSMGTLETTANLLAGTSF
GFGPQNMAPEKSGPLTGEFSVESIIDLNANYVEIGHAERKNLFHEKTSEIAKKIKLALDE
KITPVVCVGEEVRANDTNELKNALKKQIEALFQTINLAQWENVVLAYEPEWAIGKASSAE
TNYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVRQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaactatattaacactcgggctcagaca
tctgaatggttagaagcgactatccctcttcttaaaaatttttctgatgtggatacgttt
atctttccttctatgggcacactcgaaacgaccgccaaccttttagcggggacatcattt
ggctttggtccacaaaatatggcgccggagaaatccggcccgctaactggtgaattttcg
gtggaatctatcattgatctaaacgcgaactatgtcgaaattggtcacgcagaacgcaaa
aacctttttcatgagaaaactagtgagatagcgaagaagattaaacttgcattggacgaa
aaaatcactccggttgtctgtgtgggtgaagaagtccgtgcgaatgatacaaatgaatta
aaaaatgcgctaaaaaaacaaatcgaagcgctgtttcagacaattaatttagcacagtgg
gaaaatgttgttctggcttatgaaccggagtgggcaattggaaaggcgtcttcagctgag
acaaactacatcgaaagcgcgcatcaagcgctgcgtgaaattattcgcgaactaggcggc
gatgaaacgctcgtaagaattatttacggtggctcggtcagcaaagaaaacgccgcagaa
attgtccgtcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtttctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system