KEGG   Listeria monocytogenes F2365: LMOf2365_0366Help
Entry
LMOf2365_0366     CDS       T00174                                 

Gene name
tpiA-1
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmf  Listeria monocytogenes F2365
Pathway
lmf00010  Glycolysis / Gluconeogenesis
lmf00051  Fructose and mannose metabolism
lmf00562  Inositol phosphate metabolism
lmf01100  Metabolic pathways
lmf01110  Biosynthesis of secondary metabolites
lmf01120  Microbial metabolism in diverse environments
lmf01130  Biosynthesis of antibiotics
lmf01200  Carbon metabolism
lmf01230  Biosynthesis of amino acids
Module
lmf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmf_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOf2365_0366 (tpiA-1)
   00051 Fructose and mannose metabolism
    LMOf2365_0366 (tpiA-1)
   00562 Inositol phosphate metabolism
    LMOf2365_0366 (tpiA-1)
Enzymes [BR:lmf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMOf2365_0366 (tpiA-1)
Exosome [BR:lmf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMOf2365_0366 (tpiA-1)
  Exosomal proteins of bladder cancer cells
   LMOf2365_0366 (tpiA-1)
  Exosomal proteins of melanoma cells
   LMOf2365_0366 (tpiA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AAT03152
UniProt: Q723V9
Position
complement(390421..391185)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAQTSEWLEATIPLLKNFSDVDTFIFPSMGTLETTANLLAGTSF
GFGPQNMAPEKSGPLTGEFSVESIIDLNANYVEIGHAERKNLFHEKTSEIAKKIKLALDE
KITPVVCVGEEVRANDTNELKNALKKQIEALFQTINLAQWENVVLAYEPEWAIGKASSAE
TNYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVRQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaactatattaacactcgggctcagaca
tctgaatggttagaagcgactatccctcttcttaaaaatttttctgatgtggatacgttt
atctttccttctatgggcacactcgaaacgaccgccaaccttttagcggggacatcattt
ggctttggtccacaaaatatggcgccggagaaatccggcccgctaactggtgaattttcg
gtggaatctatcattgatctaaacgcgaactatgtcgaaattggtcacgcagaacgcaaa
aacctttttcatgagaaaactagtgagatagcgaagaagattaaacttgcattggacgaa
aaaatcactccggttgtctgtgtgggtgaagaagtccgtgcgaatgatacaaatgaatta
aaaaatgcgctaaaaaaacaaatcgaagcgctgtttcagacaattaatttagcacagtgg
gaaaatgttgttctggcttatgaaccggagtgggcaattggaaaggcgtcttcagctgag
acaaactacatcgaaagcgcgcatcaagcgctgcgtgaaattattcgcgaactaggcggc
gatgaaacgctcgtaagaattatttacggtggctcggtcagcaaagaaaacgccgcagaa
attgtccgtcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtttctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system