KEGG   Listeria monocytogenes F2365: LMOf2365_0596Help
Entry
LMOf2365_0596     CDS       T00174                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
lmf  Listeria monocytogenes F2365
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lmf01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:lmf00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(610723..612006)
Genome map
AA seq 427 aa AA seqDB search
MKILTGTVNELLNELKIETDTNTSIQVETEVKTIIEKVKTAGDQALFDFTSKFDGVGLTE
LRVPAADIQAASAKIEPAFLDALQQAKVNIESFHSKQKQHAFLDSEKDGVIRGQLIRPLE
TVGVYVPGGTAAYPSSVLMNVLPAKIAGVKRIVMITPPGENGINPYVLASAQLAGVDEIY
QVGGAHGIAALAHGTESIPKVDKIVGPGNIYVATAKREVFGLVDIDMIAGPSEIVVLADE
NANPAFIAADLLSQAEHDILARAILITTSKKIAEETQNEIDKQLENLPRKAIAQKSIETR
GKIIIAATTQEMFDIMNEIAPEHLEVQLENPMNYLYQIKNAGSIFLGSYASEPLGDYFAG
PNHVLPTSGTAKFFSPLGVEDFTKRSAFISYTKEALAKEKDAIVLLAKKEGLDAHAKAIQ
IRFEEEN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttaaccggaacagtaaatgagctattaaacgagctcaaaatagaaactgat
acgaacacttccatccaggtggaaaccgaagtaaaaacgattatcgaaaaagtcaaaaca
gctggcgaccaagccctatttgacttcacatccaagtttgacggcgtagggctcaccgaa
ctccgcgttccagccgctgacatccaagctgcaagcgcaaaaatcgaacctgccttctta
gacgcgctccaacaagcaaaagtaaatatcgaaagtttccacagcaagcaaaaacaacat
gctttccttgatagtgaaaaagacggcgtcattcgagggcaattaattcgtccactagaa
accgtcggcgtttacgttcccggtggcacagcagcctatccttcatcggttttaatgaat
gtgttgccagccaaaattgccggagtaaagcgaatcgtaatgattacccctcccggtgaa
aacggtattaatccttacgttctagcctcagctcaactagctggtgtggacgaaatttac
caagttggcggtgcacacggaatcgccgctctagctcacggaacagaatctatccctaaa
gtagataaaatcgtcggtcctggaaatatctatgtcgccactgccaaacgtgaagtattc
ggcttagttgatattgacatgatagccggtccatccgaaatcgtcgtgctcgcagatgaa
aacgccaatcctgcttttatcgcagccgacttactctcccaagcagagcacgatatttta
gcccgtgctatcttaatcacaactagtaaaaaaatcgccgaggaaacacaaaatgaaatt
gacaaacagctagaaaatctaccgcgaaaagcgattgctcagaaatctatcgaaacacga
ggaaaaatcattatcgcagcaaccacacaagaaatgttcgatatcatgaacgaaatcgcc
ccagaacacttagaagtacaacttgaaaatccgatgaactatctctatcaaattaaaaac
gctggctccattttcttagggagttatgcatcggaacctcttggcgactattttgctggc
ccaaatcacgtcttacctacaagtggtaccgcaaaattcttctctcctcttggtgttgaa
gattttaccaaacgttccgcctttatttcttatacaaaagaagcactcgcaaaggaaaaa
gatgctatcgttttacttgctaaaaaagaaggtctagacgcccatgccaaagccattcaa
attcgttttgaggaggaaaactaa

DBGET integrated database retrieval system