KEGG   Listeria monocytogenes F2365: LMOf2365_0903Help
Entry
LMOf2365_0903     CDS       T00174                                 

Gene name
hemG
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
lmf  Listeria monocytogenes F2365
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMOf2365_0903 (hemG)
Enzymes [BR:lmf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     LMOf2365_0903 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
923089..924468
Genome map
AA seq 459 aa AA seqDB search
MKHIVIIGGGLSGLAAAYELQKTHPNYTWELVEKDKKLGGKFETVKRDGFLIEKGPDSFL
ARKPAGVGLVKDLGLEDKLIANATGRSYIYHQKALHPIPEGSVMGIPTDKEALLASTLVS
EIGKARALQEPTMERNNQEQDQALGEFFEARFGKELVKTIIEPLLSGIYAGDIYKMSLRA
TFPQFEQAVKKYGNLMDGLKESSMQTTGTKATIGAFRTLEGGLDALPKAIAAALPKGNLH
TAKQATNITKKNSSYEISFVDGDKMEADGVIIAATHDALIHLLAEKTTEPFAGQPLTTLA
TVSLAYNEQDVPILPDGTGYLVARTAPYKTTACTWVQKKWPHMVPENKMLLRGFVGKAGE
TWLEQASDEAIVSAVLRDYAEMMDLHAAPLFYEVSRMKSAMPQYLVNHQDRLKQLKKNIK
ADYPGVYFAGMSYEGVGIPDCIAGAQTAAKELVDYLEEV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatatagtcattatcggaggcggcttatcagggcttgcagcagcgtatgaacta
caaaaaacacatccgaattatacgtgggaattagtagaaaaagacaaaaaactaggcggg
aaatttgaaacggttaaacgggacggatttttaattgaaaaaggaccagactccttttta
gcaagaaaaccagctggtgtaggcttagtgaaggatttaggactcgaagataaactgatt
gcgaacgcgacaggaagatcctacatttaccaccaaaaagcacttcatccgattccagaa
ggctcagtgatgggaattccaacagataaagaagcattgctagctagtacactcgtatcc
gaaattgggaaagctcgcgcacttcaagaaccaacaatggaacgaaataatcaagaacaa
gatcaagcacttggcgaattctttgaagcgcgattcggtaaagaattagtcaaaacaatt
atcgaaccacttttatcaggaatttatgccggagatatatacaaaatgagtttacgcgcc
acttttccacaattcgaacaagcagttaaaaaatatgggaatttgatggatggcttaaaa
gaaagtagcatgcaaacgacagggacaaaagctactattggtgcttttcgaacattagaa
ggcgggctagatgcgttaccaaaagccattgccgccgcacttccaaaaggaaatttgcat
acagcaaaacaagcaacgaacattacgaaaaagaatagctcttacgaaatttcttttgta
gatggcgataaaatggaggcagatggcgtcattatcgctgccacacatgatgcgctaatt
catttattagcagaaaaaacgacagaaccattcgcgggacaaccgcttacgactctcgca
actgtctcattagcatacaatgaacaagatgtaccgattttaccagatggaacaggctat
ctagttgccagaaccgctccatataaaaccactgcttgtacatgggtgcagaaaaaatgg
ccgcatatggtaccagaaaataaaatgttactacgaggctttgttgggaaagcgggagaa
acttggttagagcaagcaagtgatgaagcaatcgtttcagctgttttgagagattatgcg
gaaatgatggaccttcacgccgcgccacttttttatgaagtaagccgaatgaaatccgca
atgcctcaatacttagttaatcaccaggaccgactaaaacaattgaaaaagaacatcaaa
gcagattacccaggggtttattttgcaggaatgagctacgaaggtgtgggtattcctgat
tgcatcgcaggagctcaaacagccgctaaggaattagtagattacttggaagaggtgtaa

DBGET integrated database retrieval system