KEGG   Listeria monocytogenes F2365: LMOf2365_1075Help
Entry
LMOf2365_1075     CDS       T00174                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lmf  Listeria monocytogenes F2365
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:lmf01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmf00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lmf00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lmf00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1081793..1083427
Genome map
AA seq 544 aa AA seqDB search
MAYSFKLPDIGEGIHEGEIVKWFVQPGDKIEEDESLFEVQNDKSVEEITSPVSGTIKEIK
VAEGTVATVGQVLVTFDGVEGHEDDAEEESAAPKAESTESTPAPAQASGKGIFEFKLPDI
GEGIHEGEIVKWFIQPGDKVEEDQSIFEVQNDKSVEEITSPVDGTVKDILVSEGTVATVG
QVLVTFEGDFEGEASHESTPESPAEEAELTNNDATSAPVTGGNGTPSSKKDPNGLVIAMP
SVRKYAREKGVNIAEVAGSGKNNRVVKADIDAFLNGEQPAASTTTAQTEEKAAAPKAEKA
AAKQPVASSDAYPETREKLTPTRRAIAKAMVNSKHTAPHVTLMDEIEVTALMAHRKRFKE
VAAEKGIKLTFLPYMVKALVATLRDFPVLNTTLDDATEELVYKHYFNVGIAADTDHGLYV
PVIKNADKKSVFQISDEINELAGKARDGKLTADEMRHGSATISNIGSAGGQWFTPVINYP
EVAILGVGRIAQKPIVKDGEIVAAPVLALSLSFDHRVIDGATAQKAMNNIKRLLNDPELL
LMEV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcatattcatttaaattaccggatatcggtgaaggtatccatgaaggtgaaatcgtt
aaatggtttgtacaaccaggcgataagattgaagaagatgaatccctatttgaagtacaa
aacgacaaatcagtggaagaaatcacttctccagtttcaggaacgattaaagaaatcaaa
gttgcagaaggtacagttgctacagttggacaagtactagtaacatttgatggcgtagaa
ggtcacgaagacgacgccgaagaagaaagcgcagcaccaaaagcagaatccacagaatca
actcctgcacccgcacaagctagcggaaaaggaatttttgaattcaaattaccagatatt
ggtgaaggaattcatgaaggtgaaattgttaaatggtttattcaaccgggcgataaagta
gaagaagatcagtccatttttgaagtacaaaacgacaaatctgtcgaagaaattacttct
ccagtagatggaactgttaaagatattttagttagcgaaggaacagtagcaacagttggt
caagtattagtaacattcgaaggcgattttgaaggagaagctagtcatgaatctactcca
gaatctccagcagaagaagctgaacttacaaacaacgatgcaacttccgctccagttaca
ggtggaaacggaacgccatcatctaaaaaagatcctaatggccttgtaattgcaatgcct
tctgtacgtaaatatgcgcgtgaaaaaggcgttaatatcgctgaagtagcaggctctgga
aaaaataaccgcgtagttaaagctgatattgatgctttcctaaacggcgaacaaccagct
gcatcaacaactactgctcaaacagaagaaaaagcagcagcaccaaaggcagaaaaagca
gcagcaaaacaaccagttgcaagctccgatgcttacccagaaacacgcgaaaaattaaca
ccaactcgtcgtgcgattgcaaaagcaatggtaaattcaaaacatacagctccacacgtt
actttaatggacgaaatcgaagtaactgcacttatggctcaccgcaaacgtttcaaagaa
gtggctgccgaaaaaggtatcaaactaactttcttaccttatatggtgaaagctcttgtt
gcaacgcttcgtgacttcccagtgcttaacacaactttagatgatgcgacagaagaactt
gtttacaaacattacttcaacgttggtatcgcagcagatacagaccacggtttatatgta
ccagtaattaaaaatgctgataaaaaatccgtattccaaatttctgatgaaatcaacgaa
ctagctggaaaagcacgtgatggtaaattaactgctgacgaaatgcgccacggttccgca
actatttctaatatcggttctgccggcggacaatggttcactccagtaattaattaccca
gaagttgctattctaggtgttggtcgtattgctcaaaaacctatcgtaaaagatggcgaa
attgtagcagcaccagtacttgctctttccttgagctttgaccaccgtgtaattgacggc
gcaactgctcaaaaagcaatgaacaatattaaacgtttattaaacgatccagaattatta
ctaatggaggtgtaa

DBGET integrated database retrieval system