KEGG   Listeria monocytogenes F2365: LMOf2365_1356Help
Entry
LMOf2365_1356     CDS       T00174                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lmf  Listeria monocytogenes F2365
Pathway
lmf00010  Glycolysis / Gluconeogenesis
lmf00052  Galactose metabolism
lmf00500  Starch and sucrose metabolism
lmf00520  Amino sugar and nucleotide sugar metabolism
lmf00521  Streptomycin biosynthesis
lmf01100  Metabolic pathways
lmf01110  Biosynthesis of secondary metabolites
lmf01120  Microbial metabolism in diverse environments
lmf01130  Biosynthesis of antibiotics
lmf01200  Carbon metabolism
Module
lmf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOf2365_1356 (glcK)
   00052 Galactose metabolism
    LMOf2365_1356 (glcK)
   00500 Starch and sucrose metabolism
    LMOf2365_1356 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    LMOf2365_1356 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LMOf2365_1356 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LMOf2365_1356 (glcK)
Enzymes [BR:lmf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LMOf2365_1356 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AAT04131
Position
1346149..1347117
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKEGDIEEKWTIDTNIEDKGAHIVKNIGDSINQKLTDLQL
DNDIFYGIGMGTPGTVNYETGTVKGAYNLGWADEQNVSQDLENITGLKIILDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGIRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDLAKEYTGKSALKDAINNDETITSKLIFELGAEDDALANET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKTYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPSED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcgggacaacagcaaaattagctatttta
acaaaagaaggcgacattgaagaaaaatggacaattgatacaaatattgaagataagggc
gcccacattgttaaaaacattggggattctatcaatcaaaaattaacggacttacaactg
gataatgatattttttatggtattggtatgggaactccaggtactgtaaattatgaaaca
ggtactgtaaaaggtgcgtacaacttaggctgggcagatgaacaaaatgttagtcaagat
ttagaaaatattactggtttaaaaatcatattagataatgatgctaatgttgcagctctt
ggtgaacgctggaaaggcgcaggcgaaggtggggctaatgtcgttttcgtaacacttgga
acaggcgttggcggcggaattttcgcagaaggcaaaattttacatggtattcgcggagca
gctggtgaaattgggcatgtaacagtagttcctgagaatggttatgattgtacctgtggc
aaaaaaggctgtttagaaactgtcgcatcagcaacaggaatcgttcgagtagcgaaagat
ttagcgaaagagtatactggtaaatccgcacttaaagatgcaataaacaacgatgaaaca
attacttctaaattgatttttgaactaggagcagaagatgatgctttagcaaatgaaaca
attgataaaatttctttctatttggctttagcgctcagtcatattggaaacatgttaaat
ccagagaagattattattggtggtggcgtttcagcagcaggcgatcaattattaacaccg
gttaaaacttattttgagacaatggttttcccagctgttaaagaatccactaaattatct
attgcgacaaaagggaatgacgcagggataattggagctgcatggttagcactaccaagt
gaagattaa

DBGET integrated database retrieval system