KEGG   Listeria monocytogenes F2365: LMOf2365_1528Help
Entry
LMOf2365_1528     CDS       T00174                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lmf  Listeria monocytogenes F2365
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lmf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LMOf2365_1528
Enzymes [BR:lmf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LMOf2365_1528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1519683..1522079)
Genome map
AA seq 798 aa AA seqDB search
MAEQESLALFNDTPEELFMKGTMLSTIFYNAENLFSVVRILVKETNADWDEKDIIVTGFF
PALHEQEVYTFYGKMQEHAKFGQQFKADRFRKEMPQSRAGLINYLSGELFKGIGKVTAEN
IVDTIGDDAITKILSDPSLLNTVPKLPSGAAESLLASLRENQGLEHVMVGLNEYGFGPQL
SMKIFQAYKQNAIEVLENNPYKLIEDIKGIGFQRADELGRKLGLGGNHPERLRAGILFML
DSVCMQQGHVYMEQEVLLGEVTYLLEESEGIRIDQNILVAQVEKLAEEQKIITENTRVYM
PSLYYSESGFAYHVKRMLKQTEYQEQFPQSEFLLALGELEERIGVHYGDSQRQALEQALM
SPMLVLTGGPGTGKTTVIKGIVELYAELNGVSLDPHAYKDGATFPVLLAAPTGRAAKRMS
ESTGLPAMTIHRLLGMNGQEQMDDDAERLIDGRLLIVDEMSMVDIWLANQLFRALPAHMQ
VVLVGDQDQLPSVGPGQVLKDILQSEQIPTVALSDIYRQKDGSSIIEMAHYIKEGMLPAD
FTKNSADRSFFHCTVNQIGDVVEQVVKNAKNKGFRAKDIQVLAPMYRGPAGIDILNKKLQ
EIFNPNDTGRRKEVQFGDIKYRVHDKVLQLINQPEKNVFNGDIGEIVSIIYAKENTEKQD
LIVVQFDQTEVSYYRQEFNQLTHAYCCSIHKAQGSEFPIVIMPIVRSYYRMLRRDLLYTG
VTRSKQFLILCGEEEAFRMGIERIDENKRNTTLSERLMSEDVLLEQMTNKRILTAENITE
IDPMIGMEGITPEQFMAG
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaagaatcactcgctctatttaacgatacaccagaagaacttttcatgaag
ggcacgatgttgtccaccattttttacaatgccgaaaacctcttttctgttgtacgaata
ttggtcaaagaaaccaatgcggattgggacgaaaaagatattatcgtaaccggttttttc
ccagcgcttcacgagcaagaagtatacactttctacgggaaaatgcaggaacatgctaaa
tttggtcaacagtttaaagcagaccggtttcgtaaggaaatgccacaatcacgagcgggc
ttaattaattatctatccggtgaactttttaaaggcattggtaaagtcactgctgaaaat
attgtggatacgattggcgacgatgctatcacaaaaattttatccgatccgagcttgcta
aatacagtacctaagttgccatctggcgcggcagaaagtttgcttgcttcccttagagaa
aatcaagggttggagcatgtgatggtcggattaaacgaatatggctttggtccgcaatta
tccatgaaaattttccaggcctataaacaaaatgcgattgaagtgttagagaataatcct
tataaattgattgaggatataaaagggattggttttcagcgtgccgatgagcttggacgg
aaactcggtcttggcgggaatcatccagaacggcttcgtgctgggattttatttatgtta
gattcggtttgtatgcaacaaggtcatgtatatatggagcaagaggttctgctcggagaa
gtaacttatttactggaagaaagcgaaggcattcgtattgaccaaaatattttagtagct
caagtagaaaaattagctgaggaacaaaagattattacggaaaatacacgtgtttacatg
ccatcactctattattcagagagcggctttgcatatcacgtgaagcgaatgcttaaacaa
acagaataccaagaacaatttccgcaatccgaatttctgctagctctaggagaattagaa
gaacggattggcgttcactacggagattcgcagcgacaggctttagaacaagctttaatg
tctccgatgctcgtacttactggtggtcccgggacagggaaaacaacagtcattaaaggg
atagtggagctttatgcggaactaaatggtgtgagccttgatccccatgcttacaaagat
ggagcgactttccccgttcttcttgctgctccaactggccgtgccgctaaacggatgtct
gagtcaacagggcttcctgcgatgaccattcaccgtttacttggaatgaatggtcaagaa
caaatggatgatgatgcagaaagactgattgatggacgactgttgatagtggatgagatg
tcaatggtagatatttggcttgctaatcaattattccgtgctttaccagcgcacatgcaa
gtggtacttgttggcgaccaagatcagttgccttcagtcggaccaggtcaagtactcaaa
gatattctgcaatctgaacaaattccaactgtagctctttcagatatttaccgccaaaag
gatggttcttccattatcgaaatggcgcattatataaaagaaggcatgttgccagctgat
ttcaccaaaaatagcgccgatcgctccttttttcattgcacggtaaatcaaattggtgat
gtagtcgaacaagtggtaaaaaatgcaaaaaacaaaggatttcgagcaaaagacatccaa
gttttagcaccaatgtatcgtggtcctgcaggcattgatattttaaataaaaaactacaa
gaaattttcaatccaaatgatacagggcgtcgtaaagaagttcaatttggtgacataaag
tatcgcgtgcatgacaaagtactgcaattgattaatcaaccagagaaaaatgtgtttaac
ggtgatattggtgaaattgtgtctattatatacgccaaagaaaataccgaaaaacaagat
ctgattgtcgttcaatttgaccaaacagaggtttcttactataggcaagaatttaatcaa
ttgacccatgcttattgttgttcgatccataaagcgcagggaagtgaatttccgattgtg
attatgccgattgtccgcagttactaccggatgttacggcgcgatttattatacaccgga
gtaacgcgaagtaaacaatttctcattctttgcggggaagaagaagcttttcgaatgggg
atagaacgaattgatgaaaataaacgtaatacaacactctctgaacgtttaatgagcgaa
gatgttttattagaacaaatgacaaataaacgaattctcacagctgaaaatattacggaa
attgatccgatgattggaatggaagggattactccagaacaatttatggcaggataa

DBGET integrated database retrieval system