KEGG   Listeria monocytogenes F2365: LMOf2365_1656Help
Entry
LMOf2365_1656     CDS       T00174                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lmf  Listeria monocytogenes F2365
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lmf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LMOf2365_1656 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOf2365_1656 (adhE)
   00620 Pyruvate metabolism
    LMOf2365_1656 (adhE)
   00650 Butanoate metabolism
    LMOf2365_1656 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    LMOf2365_1656 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LMOf2365_1656 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LMOf2365_1656 (adhE)
   00626 Naphthalene degradation
    LMOf2365_1656 (adhE)
Enzymes [BR:lmf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LMOf2365_1656 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LMOf2365_1656 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1655655..1658255
Genome map
AA seq 866 aa AA seqDB search
MAIKENAAQEVLEVQKVIDRLADNGQKALKAFESYNQEQVDNIVHAMALAGLDQHMPLAK
LAVEETGRGLYEDKCIKNIFATEYIWNNIKNNKTVGVINEDVQTGVIEIAEPVGVVAGVT
PVTNPTSTTLFKAIIAIKTRNPIIFAFHPSAQRCSSAAAKVVYDAAIAAGAPEHCIQWVE
KPSLEATKQLMNHDKVALVLATGGAGMVKSAYSTGKPALGVGPGNVPAYIDKTAKIKRSV
NDIILSKSFDQGMICASEQAVIVDKEVAKEVKAEMEANKCYFVKGAEFKKLESYVINPEK
GTLNPDVVGKSPAWIANQAGFKVPEDTKILVAEIKGVGDKYPLSHEKLSPVLAFIEAANQ
AEAFDRCEEMLVYGGLGHSAVIHSTDKEVQKAFGIRMKACRIIVNAPSAQGGIGDIYNGF
IPSLTLGCGSYGKNSVSQNVSATNLLNVKRIADRRNNMQWFKLPPKIFFEKYSTQYLQKM
EGVERVFIVTDPGMVQFKYVDVVIEHLKKRGNDVAYQVFADVEPDPSDVTVYKGAELMKD
FKPDTIIALGGGSAMDAAKGMWLFYEHPEASFFGLKQKFLDIRKRTFKYPKLGGKAKFVA
IPTTSGTGSEVTPFAVITDKENNIKYPLADYELTPDVAIVDAQYVTTVPAHITADTGMDV
LTHAIESYVSVMASDYTRGLSIRAIELVFENLRESVLTGDPDAREKMHNASALAGMAFAN
AFLGINHSLAHKIGPEFHIPHGRANAILMPHVIRYNALKPKKHALFPRYESFRADEDYAR
ISRIIGFPAATTEEGVKSLVDEIIKLGKDVGIDMSLKGQNVAKKDLDAVVDTLADRAFMD
QCTTANPKQPLVSELKEIYLEAYKGV
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaagaaaatgcggcccaagaagtattagaagttcaaaaagtgattgacaga
ttagcagacaatggacaaaaagcattgaaagcatttgaaagttacaatcaagaacaagta
gacaatatcgttcacgcaatggcacttgccggacttgaccaacatatgccccttgcaaaa
ttagcagtagaagaaactggacgtggattatacgaagataaatgtattaaaaacatcttc
gcgacagaatatatttggaacaacattaaaaacaacaaaacagtaggcgttattaatgaa
gatgtacaaactggtgtgattgaaattgctgaaccagttggagttgttgccggggttaca
cctgtaactaacccaacatccactactcttttcaaagcaattatcgctatcaaaacacgt
aacccaatcatctttgctttccatccaagtgcacagcgttgttcatctgcagcagcgaaa
gttgtatacgatgcagcaattgcagctggagcaccagaacattgtattcaatgggtagaa
aaaccttccctagaagcaacgaaacaattaatgaatcacgataaagtagcacttgtactt
gcaactggtggtgctggaatggttaaatcagcatactctactggtaaacctgcactaggt
gttggaccaggtaacgtaccagcttacattgacaaaacagccaaaattaaacgttctgtt
aatgacattattctttctaaatcttttgaccaaggtatgatttgtgcttctgaacaagca
gtcatcgtggacaaagaagtagctaaagaagtaaaagcagaaatggaagcaaacaaatgc
tacttcgttaaaggcgctgaattcaaaaaattagaaagctatgtaatcaatcctgaaaaa
ggaacacttaacccagatgtagttggtaaatcccctgcatggattgcaaaccaagctggc
ttcaaagttccagaagatacaaaaattcttgtagctgaaattaaaggtgttggcgacaaa
tacccactatctcacgaaaaattaagcccagttcttgcattcatcgaagctgctaaccaa
gcagaagcattcgatcgttgtgaagaaatgttagtatacggaggacttggacactccgca
gttattcactctacggataaagaagttcaaaaagcatttggtattcgtatgaaagcttgc
cgtatcatcgtaaatgcaccaagcgcacaaggcggtatcggtgacatttataacggcttc
atcccttccctaacactaggttgtggatcttacggtaaaaactctgtatcacaaaatgta
agtgcgactaacttgctgaacgttaaacgtatcgcggatcggagaaataatatgcaatgg
ttcaaacttccaccaaaaattttctttgaaaaatattccactcaataccttcaaaaaatg
gaaggcgttgaacgcgtatttatcgtaactgacccaggaatggttcaattcaaatacgtg
gatgtcgtaatcgaacacctgaaaaaacgtggcaacgatgtagcttaccaagtatttgct
gacgttgaaccagatccatctgacgtaacagtttacaaaggtgcagaactaatgaaagac
ttcaaacctgatacaattatcgctcttggtggtggttctgcaatggatgctgccaaaggt
atgtggttattctatgaacacccagaagcttcattcttcggcttgaaacaaaaattctta
gatatccgtaaacgtacattcaaatatcctaaacttggtggaaaagcgaaattcgttgca
attccaacaacaagtggtacaggttctgaagtaactccatttgcggttattacagacaaa
gaaaacaacattaaataccctcttgcagactacgaattaactccagatgttgcgattgtc
gatgcacaatatgtaactactgttccagcacacattactgctgacactggtatggacgtt
ctaactcacgcaattgaatcttatgtatccgtaatggcaagcgattatactcgtggatta
tctatccgcgcaatcgaacttgtatttgaaaacttacgtgaatctgttcttactggtgat
ccagatgcgcgtgaaaaaatgcataatgcttctgccctagctggtatggcgtttgcaaat
gcgttcctaggaattaaccacagcttggcacacaaaattggacctgaattccacattcct
cacggtcgtgcgaatgcaatccttatgccacatgttattcgttataacgcacttaaacct
aaaaaacatgcgttattccctagatatgaaagcttccgtgctgatgaagattatgctcgt
atctctcgtattatcggcttccctgcagcaactacagaagaaggcgttaaatcacttgta
gatgaaatcatcaaacttggtaaagacgttggtatcgacatgagtcttaaaggacaaaat
gttgctaaaaaagatttggatgcagttgtagatacacttgcagatcgcgcattcatggac
caatgtactactgccaaccctaaacaaccacttgtaagtgaactaaaagaaatctaccta
gaagcttacaaaggtgtttga

DBGET integrated database retrieval system