KEGG   Listeria monocytogenes F2365: LMOf2365_1855Help
Entry
LMOf2365_1855     CDS       T00174                                 

Definition
(GenBank) guanylate kinase family protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lmf  Listeria monocytogenes F2365
Pathway
lmf00230  Purine metabolism
lmf01100  Metabolic pathways
Module
lmf_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lmf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LMOf2365_1855
Enzymes [BR:lmf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LMOf2365_1855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 NB-ARC AAA_16 AAA_33
Motif
Other DBs
NCBI-ProteinID: AAT04625
UniProt: Q71YI9
Structure
PDB: 

Jmol
Position
complement(1881860..1882477)
Genome map
AA seq 205 aa AA seqDB search
MTERGLLIVLSGPSGVGKGTVREAVFKDPETSFDYSISMTTRLPREGEQDGVDYYFRSRE
VFEQAIKDGKMLEYAEYVGNYYGTPLEYVEEKLAAGVDIFLEIEVQGAMQVRKAMPEGIF
IFLTPPDLSELKNRIIGRGTESMEVVEERMETAKKEIEMMASYDYAVVNDVVANAVQKIK
GIVETEHLKTERVIHRYKKMLEGLQ
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaagaggactgttaattgtactttcaggtccatctggagtaggtaagggaact
gttcgggaagctgtttttaaagatccggaaacaagttttgattattctatttccatgaca
acgcgtcttcctcgtgaaggcgaacaagacggggtcgattattattttcgttcacgagaa
gtgtttgaacaagctatcaaagacggaaagatgttagaatatgcagagtacgtcggtaat
tattacggcactccgcttgaatatgtcgaggaaaaattagccgcaggagtggatattttt
ctcgaaattgaagtacaaggagcaatgcaagttcgaaaagcgatgccagaaggaattttc
attttcttaacgccaccagatttgtctgagcttaaaaaccggattatcggtcgcggtaca
gaatcgatggaagttgtcgaggaacgcatggaaacagcgaagaaagaaatcgaaatgatg
gcgtcttatgattatgctgtggtgaatgatgtagttgcaaacgccgtacaaaaaatcaaa
ggcatcgtcgaaacagaacacttaaaaactgagcgagtaattcatcgctacaaaaaaatg
ttggagggattacaatga

DBGET integrated database retrieval system