KEGG   Listeria monocytogenes F2365: LMOf2365_2519Help
Entry
LMOf2365_2519     CDS       T00174                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lmf  Listeria monocytogenes F2365
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lmf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LMOf2365_2519 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMOf2365_2519 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LMOf2365_2519 (thrC)
Enzymes [BR:lmf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LMOf2365_2519 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2576838..2577893)
Genome map
AA seq 351 aa AA seqDB search
MYKGLLEKYKEYLPVTDKTPMISLAEGNTPLIPLPNLSKELGVTLYGKYEGLNPTGSFKD
RGMVMAVAKAKEEGAEAVICASTGNTSAAAAAYATRAGLKAYIVIPEGKVALGKLAQAVM
YGADIISIQGNFDEALKSVRELAETEAVTLVNSVNPYRLEGQKTAAFEICEQLGSAPDVL
AIPVGNAGNISAYWKGFKEWNEAKASGLPRMHGFEAEGAAAIVQGKPIDNPETIATAIRI
GNPASWELAEAARDESGGYIHSVTDDEIVNAYKKIAAQDGVFIEPGSAASLAGVIQHVAN
GTIKKGETVVCVFTGNGLKDPDTAMSVHEIPISHVDDIEAMRTHLRSGVKA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaggtttactagaaaaatataaagaatatctaccagtaactgataaaacacca
atgatctcacttgcggaaggaaatacaccacttattccattaccgaatttgtccaaagaa
ctgggtgttactttatacggaaaatatgaaggcttaaatccaaccggttcttttaaagac
cgtggaatggttatggctgttgctaaagcgaaagaagaaggtgccgaagcggttatttgt
gcatccactgggaatacttctgctgcggctgcggcatacgcaacacgtgcgggattaaaa
gcgtacattgttattccagaaggcaaagtcgctctaggaaaattagcgcaagcagttatg
tacggcgcagatattatctcaattcaaggtaattttgatgaagcgttaaaatcggttcgt
gaactggctgaaacagaagcagtaacgcttgtaaactcggtaaatccttatcgtttagaa
ggtcaaaaaacagctgcattcgaaatttgtgagcaattaggttctgctccagatgtcctt
gcaatcccagtaggtaatgccggaaacatttctgcctactggaaagggtttaaagagtgg
aatgaggccaaggcttctggacttccacggatgcatggttttgaagcggaaggtgcggct
gcgattgttcaaggtaaaccgattgataatccggaaacaattgcaacggcgattcgtatc
ggaaatccagctagttgggagcttgcagaagcagctcgcgatgaatctggcggatatatc
cattctgtaacagatgatgaaattgtaaatgcgtataaaaaaattgcagcacaagatggt
gtctttatcgagccaggttcagccgcttcattagctggtgtcatccaacatgtagcaaat
ggaacaattaaaaaaggcgaaacagtagtttgtgtctttactggaaacggcttgaaagat
ccggatactgcgatgagtgtgcatgaaattccaatttctcatgtggatgatatcgaagca
atgcgcacacatttacgttcaggagtgaaagcttaa

DBGET integrated database retrieval system