KEGG   Listeria monocytogenes F2365: LMOf2365_2524Help
Entry
LMOf2365_2524     CDS       T00174                                 

Gene name
murA-2
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lmf  Listeria monocytogenes F2365
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LMOf2365_2524 (murA-2)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LMOf2365_2524 (murA-2)
Enzymes [BR:lmf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     LMOf2365_2524 (murA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2581597..2582868)
Genome map
AA seq 423 aa AA seqDB search
MTDKLIIRGGKKLAGTLQVDGAKNSAVALIPAAILAESEVVLEGLPDISDVHTLYNILEE
LGGTVRYDNKTAVIDPTDMISMPLPSGNVKKLRASYYLMGAMLGRFKKAVIGLPGGCYLG
PRPIDQHIKGFEALGAKVTNEQGAIYLRADELKGARIYLDVVSVGATINIMLAAVRAKGK
TVIENAAKEPEIIDVATLLTNMGAIIKGAGTDTIRITGVEHLHGCHHTIIPDRIEAGTFM
VLAAASGKGVRIENVIPTHLEGIIAKLTEMGVPMDIEEDAIFVGEVEKIKKVDIKTYAYP
GFPTDLQQPLTALLTRAEGSSVITDTIYPSRFKHIAEIERMGGKFKLEGRSAVINGPVQL
QGSKVTATDLRAGAALVIAALLADGETEIHGVEHIERGYSKIIEKLSAIGANITRSSAAE
TKL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtgacggataaattgattattcgaggcggtaaaaaattagctggtactttgcaagtggat
ggcgcaaaaaatagtgcggtggcattaattccagcggcaattttggcggagtctgaagtg
gttttagaaggtttaccagatatttcggatgttcacacactttataatattttagaagag
cttggcggcacggttcgctatgataataaaacagcagttattgatccaacagatatgatt
tctatgccacttccatcgggaaatgtgaagaaattacgtgcgtcctattatttaatgggt
gcaatgttaggccgatttaaaaaagcggttattggacttccaggcggttgttacttaggg
ccacgtccaatcgaccaacatataaaaggttttgaagcattaggcgcaaaagtaacgaac
gagcaaggtgcgatttatttgcgtgccgatgaactcaaaggtgcacggatttatttagat
gttgtaagtgttggagcgacaatcaatatcatgctagcggctgttcgtgcaaaaggaaaa
acggttatcgaaaatgcagcaaaagagccagaaattattgatgttgcaacgcttttaaca
aatatgggagcaattattaaaggtgcaggaactgatactattcgaatcactggggtagag
catttacatggttgtcatcatacaattattccagaccgaatcgaagcagggacattcatg
gtacttgcagcagcttctgggaagggagtacgaatcgaaaatgttattcctacccattta
gaaggaatcattgcaaagctcacagaaatgggcgttccaatggatatcgaagaagatgct
atttttgttggggaagtagaaaaaataaaaaaagtagatattaaaacttacgcttatcca
ggcttcccaacggacttacaacaaccgttaactgctcttttaacacgtgcggaaggtagt
agtgtcatcactgatacaatttatccaagccgttttaaacacattgcggagattgaacga
atgggcggtaagtttaaacttgaaggtcgttcggctgtcataaatggtcctgtgcaactt
caaggttctaaagtgacagcgacagatttacgcgccggtgcagcgcttgtaattgcagca
cttttagctgacggagaaactgaaattcacggggtggaacatatcgaacgtggttacagt
aagattattgaaaaattatctgctattggcgcaaatattactcgtagtagcgcagcagaa
acaaaattataa

DBGET integrated database retrieval system