KEGG   Listeria monocytogenes FSL R2-561: LMKG_00511Help
Entry
LMKG_00511        CDS       T01985                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
lmg00230  Purine metabolism
lmg01100  Metabolic pathways
Module
lmg_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lmg00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LMKG_00511
Enzymes [BR:lmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LMKG_00511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 NB-ARC AAA_16 AAA_33
Motif
Other DBs
NCBI-ProteinID: AEO26175
Structure
PDB: 

Jmol
Position
complement(1922793..1923410)
Genome map
AA seq 205 aa AA seqDB search
MTERGLLIVLSGPSGVGKGTVREAVFKDPETSFDYSISMTTRLPREGEQDGVDYYFRSRE
VFEQAIKDGKMLEYAEYVGNYYGTPLEYVEEKLAAGVDIFLEIEVQGAMQVRKAMPEGIF
IFLTPPDLSELKNRIIGRGTESMEVVEERMETAKKEIEMMASYDYAVVNDVVANAVQKIK
GIVETEHLKTERVIHRYKKMLEGLQ
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaagaggactgttaattgtactttcaggtccatctggagtaggtaaaggaact
gttcgggaagctgtttttaaagatccggaaacaagttttgattattctatttctatgaca
acgcgtcttccgcgtgaaggcgaacaagacggggtcgattattattttcgttcaagagaa
gtttttgaacaagctatcaaagacggaaaaatgttagaatatgcagagtacgtcggtaat
tattacggcactccgcttgaatatgtcgaggaaaaacttgccgcaggagtggatattttt
ctcgaaattgaagtgcaaggagcaatgcaagttcgaaaagcgatgccagaaggaattttc
attttcttaacgccaccagatttatccgaactaaaaaaccggattatcggtcgcggcaca
gaatcgatggaagttgtcgaggaacgcatggaaacagctaagaaagaaatcgaaatgatg
gcgtcttatgattatgctgtggtgaatgatgttgtagcaaacgccgtacaaaaaatcaaa
ggcatcgtcgaaacagaacacttaaaaactgagcgagtaattcatcgctacaaaaaaatg
ttggagggattacaatga

DBGET integrated database retrieval system