KEGG   Listeria monocytogenes FSL R2-561: LMKG_00573Help
Entry
LMKG_00573        CDS       T01985                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lmg01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lmg00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lmg00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1690417..1691190)
Genome map
AA seq 257 aa AA seqDB search
MTKTLTNKLAEKEHAAVVTYIMGGDGGLDNLEEQLLFLEKSGVSAIEIGIPFSDPVADGP
IIQLAGLRALKEQVSLEAILNKLAMSKVQIPLIIMSYINPIFHLGIPKFVELVQKTPVKG
LIIPDLPYEHQKLITPELQGTDIALIPLVSLTSPKERLEEIAKQAEGFIYAVTVNGTTGV
RSEFDAHIDSHLAYLKSISPVPVLAGFGVSSIEHVEKFAHVCDGVIIGSKVVQMLHEEKT
AELGAFLQKAAEVRIKN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaacattaacgaataaactagcggaaaaagagcatgctgctgtcgttacttat
attatgggtggagatggtggtttagataatttagaagaacagttattgtttctagaaaaa
tctggcgtaagcgcgattgaaattggcattcctttttctgatccggttgctgacggacca
attattcaacttgctgggttacgtgctttaaaggagcaagtgagtttagaagccatttta
aataaattggctatgagtaaagtgcaaattccgctaattattatgagttatattaatccg
atttttcatttaggtattccaaaatttgttgaattggtgcagaaaacgccggtgaaaggg
cttattattccggatttaccttatgagcaccaaaaactgattacaccagaacttcagggg
acagatatcgcactcattccactcgtttcattgactagcccgaaagagcgccttgaagaa
attgcgaaacaggcagaaggatttatatatgcagtaacagttaacggaactactggtgtg
aggagtgaatttgatgcccatattgatagccatttagcttatttgaaaagcattagccct
gttccagttctcgcaggttttggtgtttcttctattgaacatgtagaaaaatttgcgcac
gtatgtgatggtgtgataatcggtagtaaagtcgtgcaaatgttgcatgaagaaaaaacg
gcagagctaggagcgtttttacaaaaggctgctgaagttcgaatcaaaaactaa

DBGET integrated database retrieval system