KEGG   Listeria monocytogenes FSL R2-561: LMKG_00654Help
Entry
LMKG_00654        CDS       T01985                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lmg00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1611832..1612554)
Genome map
AA seq 240 aa AA seqDB search
MSKKVVLTREASKNKPWQTYFSQNGYEVMSIPLIKTQPIKINLTREQQETDWLFLTSANA
VEYFFTNQYERSNYKIAVIGEKTKEKLAEFGHEPSFVPSIYQSEVFLEEWLNENPEKTSI
LLPQSNLSRTIIKDTLIEKGYIVFSIELYETIFPEASKKLLTEQLKLNETQIIVFASPSA
WKNFYSIAKSFPAQKEKWHIASIGSITTEAILADGWEVKYQPKTFTMKHLADLIIQEELK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaagttgttttaacaagagaagcgagtaaaaacaaaccatggcaaacctat
ttttcacaaaatggttatgaggtgatgtccatcccgcttattaaaacacaacctataaaa
attaatttgacccgagaacaacaagaaacagactggctttttttaacaagtgctaatgct
gtagaatatttcttcacgaaccaatatgagagatccaattacaaaatagctgtcatcggc
gaaaaaacaaaagaaaagttggcagaatttggtcacgaaccaagttttgtcccatctatc
tatcagtcagaagtatttttagaagaatggttaaacgagaacccagagaaaacaagtatc
ttactaccacaaagtaatttaagcagaacaataataaaagatacattgatagaaaaaggt
tatatcgttttttcgattgagctctacgaaacaatttttccagaggcttctaaaaaactg
ttaaccgaacaactgaaactaaatgaaacacaaataattgtttttgccagcccatctgca
tggaaaaacttctattccatcgcgaaatcattccctgctcaaaaagagaagtggcatatc
gcatcaattggtagtattacaacagaggccattctagcagatggatgggaagtaaaatat
caaccaaaaaccttcaccatgaagcacctagctgatttgataatacaggaggaattaaaa
tga

DBGET integrated database retrieval system