KEGG   Listeria monocytogenes FSL R2-561: LMKG_01568Help
Entry
LMKG_01568        CDS       T01985                                 

Definition
(GenBank) triosephosphate isomerase 2
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
lmg00010  Glycolysis / Gluconeogenesis
lmg00051  Fructose and mannose metabolism
lmg00562  Inositol phosphate metabolism
lmg01100  Metabolic pathways
lmg01110  Biosynthesis of secondary metabolites
lmg01120  Microbial metabolism in diverse environments
lmg01130  Biosynthesis of antibiotics
lmg01200  Carbon metabolism
lmg01230  Biosynthesis of amino acids
Module
lmg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmg_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMKG_01568
   00051 Fructose and mannose metabolism
    LMKG_01568
   00562 Inositol phosphate metabolism
    LMKG_01568
Enzymes [BR:lmg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMKG_01568
Exosome [BR:lmg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMKG_01568
  Exosomal proteins of bladder cancer cells
   LMKG_01568
  Exosomal proteins of melanoma cells
   LMKG_01568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEO24644
Position
complement(373743..374507)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAQTSEWLEATIPLLGNFSDVDTFIFPSMGTLETTANLLAGTSF
GFGPQNMAPEKSGPLTGEFSVESIIDLSANYVEIGHAERKNLFHEKTSEIAKKIQLALDE
KITPVVCVGEGIRANDTNELKNALKKQIEALFDTIQVTQFKNVVLAYEPEWAIGKANSAD
TDYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVRQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaactatatcaatactcgggctcagaca
tctgaatggttagaagcgactatccctcttcttggaaatttttctgatgtggatacgttt
atctttccttctatgggcacactcgaaacgactgccaaccttttagcggggacatcattt
ggttttggtccacaaaatatggcgccggagaaatccggcccgctaactggtgaattttcg
gtagaatcaatcattgatttaagcgcgaactatgtcgaaattggtcacgcagaacgcaaa
aacctttttcatgagaaaactagtgagatagcaaagaaaatccaactcgcgctggatgaa
aaaatcactcctgtagtatgtgtgggtgaaggcattcgcgcaaatgatacgaacgaatta
aaaaatgcgcttaaaaaacaaatcgaagcgctatttgacactattcaagtaacacaattt
aaaaatgtcgttctggcttatgaaccggaatgggcaattggcaaggcaaattccgctgac
acagactacatcgaaagcgctcatcaggctttgcgtgaaattattcgcgaactaggcggt
gatgaaacgctcgtaagaattatttacggcggctcggtcagcaaagaaaacgccgcagaa
attgtccgtcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtttctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system