KEGG   Listeria monocytogenes FSL R2-561: LMKG_01659Help
Entry
LMKG_01659        CDS       T01985                                 

Definition
peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lmg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LMKG_01659
  Amino acid metabolism
   00300 Lysine biosynthesis
    LMKG_01659
Enzymes [BR:lmg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LMKG_01659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
287772..288911
Genome map
AA seq 379 aa AA seqDB search
MDQQKKIQILKDMINIDSTNGHEEQVANYLQKLLAEHGIESEKVQYDVDRASLVSEIGSS
NEKVLAFSGHMDVVDAGDVSKWKFPPFEATEHEGKLYGRGATDMKSGLAAMVIAMIELHE
EKQKLNGKIRLLATVGEEIGELGAEQLTQKGYADDLDGLIIGEPSGHRIVYAHKGSINYT
VKSTGKNAHSSMPEYGVNAIDNLILFYNEIEKYVASIHATNEILGDFIHNVTVINGGNQV
NSIPEKAELQGNIRSIPEVDNETLKRRIVEIVNELNKKEHVKLELLFDYDKQPVFSDRNS
SLVNVARDVAKGIIKEEIPLLGISGTTDAAEFTKAKKEFPVIIFGPGNETPHQVNENVSI
GNYLEMVDVYKRIAIEFLS
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggaccaacaaaaaaagattcaaattttaaaggacatgataaatattgattcgactaat
gggcatgaagaacaagttgcgaactatttgcaaaagttgttagctgaacacggtattgag
tccgaaaaggtacaatacgacgtagacagagccagcctagtaagcgaaattggttccagt
aacgagaaggttttggcattttcagggcatatggatgtagttgatgcgggtgatgtatct
aagtggaagttcccaccttttgaagcgacagagcatgaagggaaactatacggacgcggc
gcaacggatatgaagtcaggtctagcggcgatggttattgcaatgattgaacttcatgaa
gaaaaacaaaaactaaacggcaagatcagattattagcaacagttggggaagaaatcggt
gaacttggagcagaacaactaacacaaaaaggttacgcagatgatttagatggtttaatc
atcggcgaaccgagcggacacagaatcgtttatgcgcataaaggttccattaattatacc
gttaaatccactggtaaaaatgcccatagttcgatgccagagtatggtgtgaatgcaatt
gataatttgatactattttataatgaaatagaaaaatacgttgcttccatccatgccaca
aatgaaatacttggcgattttattcataatgtcacggtgattaatggcggaaatcaagtc
aatagtattccggaaaaagcagaactacaaggtaatattcgttccataccagaagttgat
aacgagactttgaagcgacgtattgttgaaattgtgaatgagttaaataaaaaagaacat
gtgaagttagagttactgttcgattatgataaacagcctgtatttagcgataggaattca
agcttagtgaatgtcgcacgtgatgttgcgaaaggtattattaaagaagagataccctta
cttggaatttctggaacaacagatgcagctgaatttaccaaagctaagaaagagttccca
gtgattatttttggaccaggaaacgaaacccctcaccaagtaaacgaaaatgtttctata
ggaaattatttggagatggtagatgtttacaaacggattgccatcgagtttttatcttga

DBGET integrated database retrieval system