KEGG   Listeria monocytogenes FSL R2-561: LMKG_01663Help
Entry
LMKG_01663        CDS       T01985                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmg00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
280939..282399
Genome map
AA seq 486 aa AA seqDB search
MTEVKKQFPKGFLWGGATAANQVEGAYDVDGKGLSTADMVKFIPKEERTKDLELDVSKAE
IEAIIAGKVEGRFPKRDGVDFYHHYKEDIALFAEMGFKTFRLSLNWARIFPNGDDKEPNE
KGLEFYDKVFDELLKYDIEPLVTLSHYETPLNLTLKYNGWADRRVIGFFTNYAETVFKRY
KNKVKYWLTFNEINVISLSAYTGGGVLLEDAKNPLELSYQAGHHQFVASALATKLAHEII
PGSQVGCMLARMATYPATNNPDDILKAQYENQQNLFFTDVHARGEYPSFMNRFFQENDIH
IVKEVGDDEILKAHTVDFISFSYYMSLSATASPEGDRSAGNLMGGVKNEYLESSDWGWQI
DPKGLRWTLNDLYSRYELPLFIVENGLGAYDTVEEDGKIHDDYRIDYLRKHIEQMKEAIA
DGVDLMGYTSWGPIDLVSASTSEMSKRYGFIYVDQDDWGKGTLERSRKDSFFWYKKVIET
NGEDLD
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtgaaaaaacaatttccaaaaggatttttatggggtggagcaactgctgcg
aaccaagttgaaggcgcttacgatgtagatgggaaaggcctttccacagcagatatggtc
aaatttattccgaaagaagaacgcacgaaagaccttgaactagatgtttctaaagcagaa
atcgaagcaattatcgcagggaaagtagaaggcagattccctaaacgtgatggcgttgat
ttttatcaccactataaagaagacatcgcattatttgccgaaatgggctttaaaacattc
cgactatcactaaactgggcgcgtattttcccgaatggtgatgacaaagagccgaatgaa
aaaggccttgaattttatgacaaagtgtttgatgaattattaaaatatgacattgagcca
cttgtgacactttctcactatgaaacgccactaaatcttactttaaaatataacggttgg
gctgatcgtcgcgttatcggatttttcacgaactacgcggaaacagttttcaaacgttat
aaaaacaaagtaaaatattggttaacttttaacgaaatcaatgttatttcacttagcgca
tacactggtgggggcgtgcttttagaagacgcgaagaatccacttgaactttcttatcaa
gcaggacatcaccaattcgtagccagtgctcttgcaacaaaattggcgcatgaaattatt
cctggatcacaagttggttgtatgttagcgcgtatggcgacttatccagcgactaacaat
ccagatgatatcctaaaagcacaatacgaaaatcaacaaaatctatttttcacagacgtt
catgctcgcggtgaatatccaagcttcatgaatcgtttcttccaagagaacgacattcac
atcgtaaaagaagttggcgacgacgaaatcttgaaagcacatacagttgatttcatttca
ttcagctattacatgtccctgtccgcaacagctagcccagaaggcgaccgctctgccggg
aacttaatgggtggcgtgaaaaatgaatacttggagtcgtccgattggggttggcaaatt
gaccctaaaggcttgcgctggacactaaatgatctttatagccgctacgaattaccactt
ttcatcgtggaaaatggcttaggtgcttatgatacagtagaagaagatggcaaaatccat
gacgattaccgcattgactacctgcgcaaacatatcgaacaaatgaaagaagcaattgct
gacggcgtagatttaatgggttacacaagctggggtccaatcgacctagtaagtgcctcc
acaagcgaaatgtccaaacgttacggcttcatctacgtagaccaagatgactggggcaaa
ggaacattagaacgctcccgcaaagattcattcttctggtataaaaaagtaattgaaaca
aatggtgaagatttagattaa

DBGET integrated database retrieval system