KEGG   Listeria monocytogenes FSL R2-561: LMKG_01690Help
Entry
LMKG_01690        CDS       T01985                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:lmg00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    LMKG_01690
Enzymes [BR:lmg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     LMKG_01690
Amino acid related enzymes [BR:lmg01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   LMKG_01690
Transfer RNA biogenesis [BR:lmg03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LMKG_01690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
256899..258374
Genome map
AA seq 491 aa AA seqDB search
MSETKRVRVRYAPSPTGFLHIGNARTALFNYLFARHNDGDFIIRIEDTDAKRNIADGEES
QMTNLKWLGMDWDEGVDVPGKYGPYRQSERQSIYEPLIQELLDKDLAYKCYCTEEELDAE
REKQKANGEMPRYSGKCRHLTKEQQAEKEAQGFKPSIRFKVPANETITFNDMVKDDVSFE
SNGIGDFVIAKKDGIPTYNFAVAVDDHLMEISHVLRGDDHISNTPKQILIYNAFGWEPPI
FGHMTLIVNESRRKLSKRDGSIIQFIEQYRDLGYLPEALFNFIAMLGWSPEGEEEIFSKE
EFIKMFDPKRLSKSPALFDNVKLTWVNNQYVKKLPLNDVVELSLPHLQKAGVVSAELNQA
ELDWVHKLVSLYHEQMSYGAEIVPLSEMFFADAESITFDEEETAVLAEETVPTVISAFKK
ELEALEVLEAAEVKAAIKRVQKETGVKGKGLFMPIRIVTTGEMHGPELPLAIEVLGREKV
LNRLDTWLKNN
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaaacaaaacgagtgcgtgtacgttatgcaccaagtccaactggatttttgcat
attgggaatgcacgtactgccttatttaactatttatttgcaagacataatgatggagat
tttatcattcgtattgaagacactgatgctaaacgtaacatagctgacggtgaagaaagt
caaatgacaaacttgaaatggcttggtatggactgggatgaaggtgttgatgttcctgga
aaatacggaccttaccgtcaatccgaacgtcaatcaatctatgagccgctaattcaagag
cttttggataaagatttggcatataaatgctattgtacagaagaagaattagatgcagaa
cgtgaaaaacaaaaagcaaatggtgaaatgcctcgttatagtgggaaatgtcgtcattta
acaaaagaacagcaagcggagaaagaagcgcaaggttttaaaccgagtattcgtttcaaa
gtgccggcaaatgaaacgattactttcaacgatatggtgaaagacgatgtttcgtttgaa
tcaaatggaataggcgattttgttattgcgaaaaaagacggaattccgacttataacttt
gctgtggcagtggatgatcatttaatggaaatttctcatgttcttcgtggggatgaccat
atttcgaatacgcctaaacaaattttgatttataatgcatttggctgggagccaccaatt
tttgggcatatgacacttattgtgaatgagagcagacgtaaattaagtaaacgtgatggt
tcgattattcaatttatcgaacaatatcgcgatttaggatatttaccggaagcattattt
aactttatcgctatgcttggttggtctccagaaggcgaagaagaaattttctctaaagaa
gaattcattaaaatgtttgatccaaaacgtttatctaaatcaccagcgttgttcgataat
gttaaattaacatgggtgaataaccaatatgtgaaaaaattaccgctaaatgatgtagta
gagctttctttacctcatttacaaaaagcgggtgttgtatctgctgagctaaatcaagct
gaacttgattgggtgcacaaattagtgtcactttatcatgagcaaatgagctatggtgcg
gaaattgtgccactttcagaaatgttctttgcggatgcagagtcaattacgtttgatgaa
gaagagacagcggtgttagcggaagagacagttccaactgttatttcggcattcaaaaaa
gaactagaagcactagaagttcttgaagctgcggaagtaaaagctgcaatcaagcgtgtc
caaaaagaaacgggcgtaaaaggtaaaggtctatttatgccaattcgtatcgtaactacg
ggtgaaatgcatggtcctgaattgccacttgcaatcgaagttcttggtcgtgaaaaagtg
ctgaatcgtttggacacatggttgaaaaataattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system