KEGG   Listeria monocytogenes FSL R2-561: LMKG_01727Help
Entry
LMKG_01727        CDS       T01985                                 

Definition
uroporphyrin-III C-methyltransferase/uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMKG_01727
Enzymes [BR:lmg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     LMKG_01727
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     LMKG_01727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1202713..1204194
Genome map
AA seq 493 aa AA seqDB search
MGKVMLIGAGPGDAQLLTVKGLAALQKADVIVYDRLVEPAMLQERKASCKLIYVGKEPLH
HPIPQDEIERILVREAATNELVVRLKAGDPYVFGRGGEEGETLHKAGIPFEVIPGITSAI
GGLAYAGIPVTHRDFASSFHVITGHLKKGRDPLDWEALARLEGTLVFLMGMTNLPNICAN
LLEHGQKPETGVAIVQWATRGKQLTVTGNLQTIEQKVAESGISSPALIVVGDVVSLRPQL
NFFEEMPLFHTKVLLPRARAGKSMLAEQIRDLGGEVTMYPNIQVLDVAPTKTKEQLSEVS
ELLFTSKEAVERFFDYLAKLDLDIRSLKNSHLTAIGKQTKEAFSEKGIIPDSFIKRRSTE
LILEHLPRLQKNVSNLIIGSVVDTTEVNVILADVKAIEMMPLYDMRPVTERPFDLESFEQ
VCFSSSRSVQNLLDVLTIEEKAILQTKTILSIGRFTSATLASFGMNNFIEAESATPESLI
ELIQKTKLEGVPQ
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagttatgttaattggtgcagggcctggggatgcgcaactactgacagtgaaa
ggtttagctgcactacaaaaggcagatgttattgtttacgatcgcctcgtcgaaccagcg
atgctccaagaacgaaaagctagttgtaaactaatttatgttggaaaagaaccacttcat
catccaattccacaagatgaaatcgaacgaattcttgtaagagaagcggcaacgaatgag
cttgtcgtccgtttaaaagcaggtgatccttatgtatttggacgaggtggcgaagaagga
gagacactccataaagcaggaattccgtttgaagttatccctggaatcacttcagctatt
ggtgggctcgcctatgctggaatccctgtaacacatcgtgattttgcttcaagttttcat
gtcattaccggacatttgaagaaagggcgcgatccactagattgggaagcacttgctaga
ctggaaggtacacttgttttcttaatggggatgactaatttacctaatatctgtgcgaat
ttattagaacacggtcaaaagccagaaactggtgttgcaattgtacaatgggcaactcga
ggcaaacaattaacagtaactggaaatttgcaaaccatcgaacaaaaagtagctgagtcg
ggtatttcctctccagcacttatcgttgttggcgatgtagttagcttacgaccacaactg
aacttttttgaggaaatgccactttttcataccaaagtattacttccaagagcacgagca
ggaaagagtatgctcgcggaacaaattcgtgatttaggcggagaagtaacaatgtaccca
aatattcaagtattagatgttgcgccaacgaaaacaaaagaacaactaagcgaagtaagc
gaactgcttttcacatcaaaagaagctgtagaacgattttttgattatttagccaagctt
gatttagatattcgttctcttaaaaatagccatctgacggctattggaaagcaaacgaag
gaagcatttagcgaaaaaggaattattccagatagttttattaaaagacggagcacggaa
ttgattttagagcatttaccacgattacagaaaaatgtgagtaatttaattatcggaagc
gtagttgatacgaccgaagttaatgttattttagctgatgtaaaagctattgaaatgatg
ccgttatatgatatgcgcccagtgacagaacgaccatttgatctcgaaagctttgaacaa
gtatgtttttcaagttcgcgttccgtccaaaatctacttgatgtactaacaatagaagaa
aaggcgattttacaaacgaaaacaatcctttcgattggaaggttcacgagcgcaacttta
gcgtcattcggtatgaacaatttcatagaagccgaaagcgccacaccagagagcttaatc
gaactaatccaaaaaacaaaattagaaggagtaccacaatga

DBGET integrated database retrieval system