KEGG   Listeria monocytogenes FSL R2-561: LMKG_01941Help
Entry
LMKG_01941        CDS       T01985                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lmg00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LMKG_01941
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LMKG_01941
Enzymes [BR:lmg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LMKG_01941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1013253..1013732
Genome map
AA seq 159 aa AA seqDB search
MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLEAMYKKLGGDNFEILG
FPCNQFLRQDPGSDEEILEFCQMNYGVTFQMFSKIKVKGKDASPLYKYLTEQTGGKKVEW
NFAKFLIDENGEVIERFPSKMKPEDFEDKVEALVAKVNN
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtccatgatttttctgaaaaagcaatgaacggcaaagaaatagctttaagtgat
tataaaggtaaagttttactcatagtgaataccgcgagtaaatgtggcttaacacctcaa
ttagaaggtcttgaagcaatgtataaaaaattgggtggagataattttgaaattctcggt
ttcccatgtaaccagtttttacgtcaagaccctggtagtgatgaggaaattttagaattt
tgccaaatgaattatggtgtgactttccaaatgttttccaaaattaaagtaaaaggcaaa
gatgccagcccactttataaatatttaaccgaacaaactggtggtaaaaaagtagaatgg
aactttgcgaaatttttaattgatgaaaatggagaagttattgaacgtttcccatctaaa
atgaaacctgaagattttgaggataaagtggaagcacttgttgcgaaagtaaataattaa

DBGET integrated database retrieval system