KEGG   Listeria monocytogenes FSL R2-561: LMKG_02103Help
Entry
LMKG_02103        CDS       T01985                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LMKG_02103
Enzymes [BR:lmg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LMKG_02103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2839319..2841001
Genome map
AA seq 560 aa AA seqDB search
MQTELVNQIEVKLRKIYQAAYQPAYLEKMLACAENYSNNTRGSIDTISEKNVYLIAYGDS
IFEKNKHPLQTLNEFLQEYAQDAITDVHLLPIFPSTSDDGFSVTDYKQIDEQLGDWDDVQ
KMSENFRVMLDFVANHMSKSSDWFKRFSDNEAPYNQFFIEKDSQFDYKNVTRPRTSPLFH
KYENGKELWTTFSEDQLDLNVRNIDCLVALTDVLLFYASKQATSIRLDAIGFLWKTSGTT
CMHLPETHEIISLWRLLIDELYPNLQIITETNVPHEENISYFGDGKNEANMVYQFPLPPL
VLHTFTCHDTTKLSKWAKSISQVSDTATYFNFLESHDGIGMRPATGILSDEEINSLVQKA
VQNGGQVSYKDNADGTQSVYELNINYGEALQNLDEDTTEELVTKKIIAAHSILLTLQGVP
AIYYHSLLGSKNDLVGYEESGINRRINREKLEKNQLVHELKTDTYRKTIFTSLKKLVQIR
RNHTAFSPFATQEILDLGPDVFAIKRESEGECIYGIINVTSHDISKKVAFSGTNLLANQP
VTSELELTAYEVVWIKKAVQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgaactggttaatcaaatagaagtaaaactaagaaaaatttatcaagccgca
taccaacccgcatacttggaaaaaatgctcgcatgcgctgaaaactattctaataatacg
cgtggttctattgatactatttccgaaaaaaatgtctatcttattgcctatggcgacagc
attttcgaaaaaaacaaacatccgttacaaacattgaatgaattcctacaagaatatgca
caagatgctattacagacgtccacttactaccgattttccctagtacgtcagatgatggc
ttctctgtcacagactacaagcaaattgacgaacagcttggcgactgggatgacgttcaa
aaaatgtctgagaacttccgagtgatgcttgatttcgtagccaatcatatgtcgaaatca
agtgattggttcaagcgattctccgataacgaagcgccgtacaatcaatttttcatcgag
aaggacagccaattcgattataaaaatgttactcgcccgcggacttctccgctgttccac
aaatacgaaaacggcaaggaactttggactacttttagcgaagaccagttagacttaaat
gtccgtaatatcgattgccttgtagccttaacagatgtcctgcttttctatgcatccaaa
caagcgacaagcattcgtcttgatgctattggatttttatggaaaacatctggcacgact
tgtatgcacctaccagaaacgcatgagatcatttcgctttggcgtctgctgattgatgag
ctatatccgaatctgcaaattatcacagaaaccaacgtccctcatgaagaaaacattagt
tattttggcgatggcaaaaatgaagcaaatatggtttatcagttcccgcttccgccactt
gtgctccataccttcacttgccatgatacaacgaaactttcgaagtgggcgaaatccatt
tcacaagtttctgacacagcgacttattttaacttcttagaaagtcatgacggaattggt
atgcgccctgcgaccggaattctttccgacgaagaaatcaattctctcgtccaaaaagcg
gtccaaaacggtggacaagtttcctataaagacaatgcagatggcacgcagtcggtatat
gaacttaatattaactacggtgaagccttgcaaaatctagacgaagacacaaccgaagaa
ctcgtaacaaagaaaattatcgctgctcacagtattttactaacacttcaaggtgtccca
gcgatttactatcattcccttctaggctcaaaaaacgaccttgttggttatgaagaatca
ggtattaatcgtcgaattaaccgtgaaaaactggaaaaaaatcaattggttcatgaactt
aaaacagacacttatcgcaaaaccattttcacatcgctgaaaaaattggtgcaaatcaga
cgaaaccacaccgctttttcaccatttgcaacccaagaaattttagatttaggaccagat
gtttttgcgataaaacgggaatctgagggagaatgcatttatggaatcatcaacgttact
tctcacgatatcagcaaaaaagtcgctttctctggcactaatttgttagccaatcaaccc
gttacgagtgagctcgaattaactgcatatgaagttgtctggattaagaaggcggtccaa
tga

DBGET integrated database retrieval system