KEGG   Listeria monocytogenes FSL R2-561: LMKG_02118Help
Entry
LMKG_02118        CDS       T01985                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
lmg00010  Glycolysis / Gluconeogenesis
lmg00620  Pyruvate metabolism
lmg00640  Propanoate metabolism
lmg00680  Methane metabolism
lmg01100  Metabolic pathways
lmg01110  Biosynthesis of secondary metabolites
lmg01120  Microbial metabolism in diverse environments
lmg01130  Biosynthesis of antibiotics
lmg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMKG_02118
   00620 Pyruvate metabolism
    LMKG_02118
   00640 Propanoate metabolism
    LMKG_02118
  Energy metabolism
   00680 Methane metabolism
    LMKG_02118
Enzymes [BR:lmg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LMKG_02118
Lipid biosynthesis proteins [BR:lmg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LMKG_02118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEO27073
Position
2824630..2826207
Genome map
AA seq 525 aa AA seqDB search
MNSENLIAPELYNITDEIAKFSSEKTALIWKNEHGETKTWSYHHLLEQANKFANVAKDAG
IKKGDHVIVMTPRLLETYAIYMGLWKAGAIIIPASELLKAHDLEYRIHHANVKAIVSYNG
MTAEFDKIESIPSVSKKIIVGDKLSGWEQYETLMEAAPTEFERVETSRDDACLLAFTSGT
TGNPKGVVHIHGWGYAHIRIAADHWLDIHEDDIVWATAGPGWQKWVWSPFLSVLGKGATG
FIYNGRFIPEKQLHLLEEEKINVLCCTPTEYRLMAKVNNLREHDLSSLRSAVSAGEPLNR
EVIQVFRDNFDIKVRDGYGQTESTLLIGTLVDTPIRPGSMGKPIMPEYMAIIDADGNPVG
VGEIGDIAMRRDFPALFKEYYKEPERLQKAIRGDYFVSGDRAIRDEDNYYWFQGRNDDII
ISSGYTIGPFEVEDALTHHPAVKEVAVVASPDEIRGTVVKAFIVVKDGYKGTDDLVHELQ
TFTKEQTAPYKYPRRIEFVEALPKTDSGKIRRVELRDAEFASVHG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagaaaatttaatcgctccagaactttataatattaccgacgagattgctaaa
ttcagttctgaaaaaacagctttaatttggaaaaatgagcacggggaaacaaaaacttgg
agttaccaccatttgcttgaacaagcgaataaatttgccaatgttgcaaaagatgccggc
attaaaaaaggcgaccacgttatcgtcatgacacctagattactcgaaacgtacgcaatt
tatatgggcttatggaaagctggtgccattattatcccggcatccgaactccttaaagca
cacgatttagaatatcgtatccaccacgcaaacgtaaaagcaatcgtttcttacaatgga
atgactgctgaatttgataaaattgaaagcatcccttctgtttcgaaaaaaattattgtt
ggagataaattatctggatgggaacaatatgaaacattaatggaagctgctccaactgag
tttgaacgtgtagaaacctctcgcgatgacgcttgtctacttgctttcacaagtggaaca
acgggtaaccctaaaggtgttgtacatattcacggttggggttacgcgcatatccgtatt
gcggccgatcattggctagatattcacgaagacgatatcgtttgggctacagctggcccc
ggttggcaaaaatgggtttggtctcccttcctttctgtacttggaaaaggcgcgactggc
ttcatttacaacggtcgtttcattccagaaaaacaactccatttactggaagaagaaaaa
atcaacgtgctctgctgtacgccaacagaatatcgcttaatggcaaaggttaataatttg
cgcgaacatgatttaagttcccttcgtagcgccgtatcagcaggagaacctctaaaccgc
gaagtaattcaagttttccgagataattttgatattaaagttcgcgacggctacggtcaa
acggaaagtacgctgttgattggaacacttgttgatacgccgattcgtcctggttcaatg
ggcaaaccaattatgcctgaatacatggcgattattgatgctgacggaaatccagttggt
gtcggtgaaattggtgatatcgcgatgcgtagagatttcccagcacttttcaaagaatac
tataaagaaccagaacgtttgcaaaaagcgattcgtggtgattatttcgtttctggtgac
cgcgctatccgcgatgaagataattattactggttccaagggcggaatgacgatattatt
atcagctctggctacacgattggcccgttcgaagtcgaggacgcgctcacacatcaccca
gccgtaaaagaagtcgctgttgtcgcaagtcctgacgaaatccgcggaaccgttgtaaaa
gcgtttatcgtcgtaaaagatggctacaagggcaccgatgatcttgtgcatgaattacaa
acatttacgaaagaacaaaccgctccctataagtatccgcgccggattgagtttgttgag
gcattaccgaaaactgattctggtaaaattcgtcgcgttgagttgcgtgatgcggagttt
gctagtgtgcatggataa

DBGET integrated database retrieval system