KEGG   Listeria monocytogenes FSL R2-561: LMKG_02314Help
Entry
LMKG_02314        CDS       T01985                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMKG_02314
Enzymes [BR:lmg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LMKG_02314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
21588..23021
Genome map
AA seq 477 aa AA seqDB search
MTESKFPKDFLWGGAVAANQCEGAYLEDGKGLSLVDILPTVEDGRWEALFNPSKALATDY
GFYPSHESIDFYHRYKEDIKLMAEMGFKCFRMSISWPRIFPNGDETTPNEKGLAFYDAVF
DECHKYGIEPVVTINHFDTPLEVFKKYGGWKNRKCIDFYLNFCEAIFTRYKDKVKYWMTF
NEINMILHLPYIGGGLDVTKEDNPEEVKYQAAHHQLVASALATKLGHEINPENQIGCMLA
AGNTYPMTCNPKDVWKSIEADREGYFFIDVQARGYYPSYTKRFFKEHNINIKMEDGDLDA
LRDHTVDYVAFSYYSSRLTSADPEKNKETEGNVFATLKNPYLKASEWGWQIDPLGLRITM
NTIYDRYQKPLFIVENGLGAVDTVEEDGSITDDYRIDYMREHVREMGEAIEDGVELLGYT
PWGCIDLVSAGSGEMKKRYGFIYVDRDNKGNGTLNRSKKKSFDWYKKVIETNGKDID
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacagaatcaaaatttcctaaagactttttatggggcggagcagttgctgccaaccaa
tgtgaaggagcttatcttgaagacggtaaaggactttcacttgttgatatccttccaaca
gtagaggacggacgttgggaagctttattcaatccatcgaaagcgcttgctacagattat
ggtttttacccaagtcacgaatcaattgatttttatcatcgttataaagaagacattaaa
ttaatggctgaaatgggattcaaatgtttccgtatgtccatcagttggccacgtattttc
ccgaatggtgatgaaacgacaccaaatgaaaaaggtttagcattttatgatgcagttttt
gatgaatgtcacaaatatggtatcgaaccagttgttacaatcaaccattttgatactccg
ctagaagttttcaaaaaatatggtggttggaaaaatcgtaaatgcatcgacttttacttg
aatttctgtgaagcaattttcacgcgttataaagataaagtaaaatattggatgacattt
aatgaaattaacatgattcttcatcttccatacattggtggaggtttagacgttactaaa
gaggataatccagaggaagttaaatatcaagctgctcatcatcaattagttgcatcagca
cttgcaactaaacttggtcatgaaatcaatcctgaaaatcaaatcggttgtatgcttgca
gcgggtaacacatatccaatgacttgtaatccaaaagatgtctggaagtctatcgaggcg
gaccgtgaaggctacttcttcattgatgttcaagcacgcggatactacccaagctacact
aaacgtttcttcaaagaacataacatcaacatcaaaatggaagatggcgacttagacgca
ttacgcgatcacacagttgattatgtggcattcagctactattcttctcgtctaacaagc
gcagatccagagaaaaacaaagaaacagaaggcaacgttttcgcaacactaaaaaaccca
tacctaaaagcaagcgaatggggctggcaaattgatccactaggtctacgtattactatg
aatacaatttacgaccgttaccaaaaaccacttttcatcgttgaaaatggcttaggtgca
gtggatactgtggaagaagacggctcaatcactgacgattacagaatcgactacatgcgt
gaacatgttcgcgaaatgggcgaagcaatcgaggacggagtagaacttcttggctataca
ccgtggggctgcatcgatcttgtcagcgctggctctggcgaaatgaaaaaacgctacggc
ttcatctatgttgaccgcgacaacaaaggcaacggaacattaaaccgctcgaagaaaaaa
tcattcgactggtacaaaaaagtaattgaaacaaatggtaaagatatcgactag

DBGET integrated database retrieval system