KEGG   Listeria monocytogenes FSL R2-561: LMKG_02469Help
Entry
LMKG_02469        CDS       T01985                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
lmg00010  Glycolysis / Gluconeogenesis
lmg00030  Pentose phosphate pathway
lmg00051  Fructose and mannose metabolism
lmg00680  Methane metabolism
lmg01100  Metabolic pathways
lmg01110  Biosynthesis of secondary metabolites
lmg01120  Microbial metabolism in diverse environments
lmg01130  Biosynthesis of antibiotics
lmg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMKG_02469
   00030 Pentose phosphate pathway
    LMKG_02469
   00051 Fructose and mannose metabolism
    LMKG_02469
  Energy metabolism
   00680 Methane metabolism
    LMKG_02469
Enzymes [BR:lmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LMKG_02469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: AEO25128
Position
complement(858337..860298)
Genome map
AA seq 653 aa AA seqDB search
MKTIDMKYLRLLAKEYPTIAKTATEIINLEAIMNLPKGTEHFLSDVHGEYSAFEQVLRNG
SGVVKRKIRDIFGAELDDAEINSLSTLIYYPEEKMDLIASETEDLHAWYRTTLFRLIELC
QYVASKYTRSKVRKAMPEDFAYILEELLHENYNEDDKKLYYEEILQHIISLGRAEEFISA
LSLLIQQLVVDHLHIVGDVYDRGPYPDKIMDTLMNYHSLDFQWGNHDILWMGAASGSRVC
AANVIRISARYLNLDILEDSYGISLRPLALFADEVYKDDPCTYFQPKNEENINYSNAEIT
QIARMHKAISIIQFKLEGEIIKRRKEFDMNHRLLLQFIDYKKGTIQLKGKEYQLLDNHFP
TINPENPYELTDAERELIGKITAAFKNCRRLQKHVQFLYSKGSMFLTYNGNLLYHGCIPL
HKDGTFMEMKLRGEKYAGRALLEQFEILTREAYVRPTGTKEKKYACDIVWYLWTGAISSL
FGKSEMTTFERYFVAEKETHTEEKNPYYKLRNNELICKQILEEFELDGECGHIINGHTPV
KEGKGESPIKASGKMLVIDGGFAKAYHKETNLAGYTLLFNSYGLQLVSHQPFTTKEDAIK
NETDILSTRQVIEMEINRKRVRDTDIGAKLSEQAEDLKLLLDAYRNGLLHENR
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaactattgatatgaaatatttacgcttgttagcaaaagaatatcctactatcgcc
aagacagctacggaaatcattaacctcgaagcaattatgaaccttccaaaaggaacggaa
cattttttaagtgatgttcacggtgaatatagtgcttttgaacaagtgcttcgtaatggt
tctggtgttgtaaaacggaaaattcgtgatatttttggcgcagagctagatgatgcagag
attaattcacttagtacactgatttattatccagaagaaaagatggatttgattgctagt
gaaacagaagatttgcatgcttggtatcgcaccacactttttcgtttgattgaactctgc
cagtatgttgcttcaaaatacacacgttctaaagttagaaaagccatgccagaagatttt
gcctacatattagaagagttacttcatgaaaactacaatgaagacgataaaaagctttat
tatgaagaaattttacaacatattatttcacttggtcgtgcagaagaatttattagcgct
ctctcactacttattcaacaattggtcgtggatcatttgcacattgttggtgatgtttat
gatcgtggcccttatccagataaaatcatggatacattaatgaattaccattcgctcgat
ttccagtggggtaatcacgatattttatggatgggcgcggctagtggctctagggtttgt
gcggctaatgttattcggatttctgctcgctatttaaatttagatattttagaagatagt
tacggtatttcccttcgccccctagccctttttgccgacgaagtgtacaaagacgatcct
tgtacctacttccagccaaagaatgaagaaaatatcaactatagtaatgctgaaatcacg
caaattgctaggatgcacaaggctatctcgattattcagtttaaattggaaggtgaaatt
attaaacgacgcaaagaatttgatatgaatcatcggcttttacttcaatttatcgattac
aaaaaaggcacaattcaactaaaaggaaaagaataccagttgttagacaatcattttcca
acgattaatccagaaaatccttatgaacttactgatgcggagagagaacttattgggaaa
attactgccgcttttaaaaactgccgccgattgcaaaaacatgtacaatttctatattca
aaaggcagcatgtttttaacttataatggcaatttactctaccatggctgcattccgctc
cacaaagatgggacttttatggaaatgaaattacgtggcgaaaaatatgctggtcgtgcg
cttttagagcagtttgaaatacttacccgcgaagcatacgtccgcccaactggaacaaaa
gaaaagaaatatgcgtgtgatatcgtttggtatttgtggactggtgccatttcttcgcta
ttcggaaaaagtgaaatgactacgtttgaacgttattttgttgcagaaaaagaaacccac
acagaggaaaaaaatccttattataaattgcgtaataacgaattaatttgcaaacaaatt
ttagaagaatttgagcttgacggagaatgcgggcatatcattaacggccatacgccagtc
aaagaaggaaaaggtgaaagtccgattaaagcgagtggtaaaatgctcgtcatcgatggc
gggttcgcaaaagcatatcataaagagacaaacttagcgggttatacactacttttcaac
agttacggtttacaactagttagtcatcagccatttactacaaaagaggatgctatcaaa
aatgaaacggatattctttccacgcgtcaagttatcgaaatggaaattaaccgtaaacgt
gtaagggataccgatattggggctaaacttagtgaacaggcagaagatttaaaattgcta
ctagatgcttatcgtaatggtttgcttcatgaaaaccgttaa

DBGET integrated database retrieval system