KEGG   Listeria monocytogenes FSL R2-561: LMKG_02562Help
Entry
LMKG_02562        CDS       T01985                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMKG_02562
   00052 Galactose metabolism
    LMKG_02562
Enzymes [BR:lmg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     LMKG_02562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2569695..2570738)
Genome map
AA seq 347 aa AA seqDB search
MKERFGEFEGETVWKWTMINDHDMRMSVLNYGAIVTSLETKDKFGDFANISLGFTNLDDY
LAHSPYFGATLGPVAGRITNGQFSLDGKQFQLIQNEGSNHRHGGKFNFSKKLWDVSVEKS
LDQIVMTFEYCWADGENGYPGKIDAKMTYTLNNKNEWLVDYEARSNQPTIYNPSNHIYFN
LSGEAGSTVLQHQLWVNSDSFLPIDEEFLPIGEKRLAENTIFDLRAGREVAEITQSQDQQ
VKLVGAGLDHTFILKHENGRPDAVLFDPKSGRRLEMETKADSVLIYTANSLDGSFEIDER
AVPKYAGITMETQGLVDAINHEGFGDIVLRPEKPFTSRTAFRFTVES
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagcgatttggggagtttgaaggagaaactgtttggaagtggacgatgataaat
gatcatgatatgcgcatgagtgttttaaattacggagcgattgttacttcacttgaaaca
aaagataaatttggtgattttgcgaatattagtcttggttttacaaatttagatgattat
ttggcacactctccttacttcggcgcgacacttggccctgttgctggacgtattacaaat
gggcaatttagtttggatggcaaacaatttcaactgattcaaaatgaaggctctaaccat
cgtcacggtgggaaattcaattttagtaagaagctttgggatgtttcagtagaaaaaagt
cttgatcaaattgtgatgacttttgaatactgctgggcggatggagaaaatggctatcca
ggaaaaattgatgcaaaaatgacatatacgttaaataataaaaatgaatggctggttgat
tatgaagcgagaagcaatcagccgactatatataacccgagcaatcatatttattttaat
ctgagcggagaagctggttcaacggttttacaacatcagctttgggtcaatagtgatagc
ttcctaccaattgatgaagagttcctcccaattggggaaaagcggttagcggaaaatact
atctttgatttgcgtgcaggtcgtgaagtagcggagattacacaaagtcaggaccagcaa
gtaaaattagttggtgcggggctggatcatacgttcattttaaaacatgaaaatggtcgt
ccagatgcagttttgtttgatccaaagtcaggacggcgcttggaaatggaaaccaaagct
gactcggtattaatttatacggcgaatagtttggatggctcttttgagattgacgagcga
gctgtgccaaaatatgctggcataacaatggaaacacagggtttggtggatgcgattaac
catgagggatttggtgatattgtacttcgaccagaaaaaccttttacatctagaacagct
tttcgtttcacagtggagagctga

DBGET integrated database retrieval system