KEGG   Listeria monocytogenes FSL R2-561: LMKG_02679Help
Entry
LMKG_02679        CDS       T01985                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMKG_02679
   01230 Biosynthesis of amino acids
    LMKG_02679
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMKG_02679
   00051 Fructose and mannose metabolism
    LMKG_02679
   00562 Inositol phosphate metabolism
    LMKG_02679
Enzymes [BR:lmg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMKG_02679
Exosome [BR:lmg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMKG_02679
  Exosomal proteins of bladder cancer cells
   LMKG_02679
  Exosomal proteins of melanoma cells
   LMKG_02679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2547645..2548400)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEGTDLR
VSAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAIFKHG
MTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSVIAYEPIWAIGTGKSSTS
ADANETCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALVGGASLEP
ASFLALLEAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgctggtaactggaaaatgaacaaaactgctgcaaaagcagga
caatttgcagaagacgtaaaaaataacgtgccatcaagcgatgctgttgaatcagtagtt
gctgcaccggctctatttttacaagaattagttcgtcttactgaaggaactgatcttcgt
gtatctgcacaaaactgttattttgaagacgaaggtgctttcactggcgaaattagcccg
tttgcacttgctgatttaggtgtttcttatgttattatcggacactctgaacgtcgtgag
tacttccacgaaacagacgaagatattaacaaaaaagcacatgcaatcttcaaacacggc
atgacaccaatcatttgctgtggtgaaacattagatcaacgtgaagctggtcaaacagat
acttgggtacgtggtcaaatccgtgcagctcttgctggattaacggaagaacaagtaatc
aaatctgttattgcttatgaaccaatttgggcaatcggtactgggaaatcttctacaagt
gctgatgcaaacgaaacttgtgcagttattcgtgcagaagttgctgacgctgtatctcaa
aaagcagcagacgcagttcgtattcaatacggcggtagcgtaaaacctgaaaacattgct
gattatcttgcagagtccgacattgacggcgctcttgtaggtggagcaagcttagaacca
gcatcgttcttagcattattggaggcagtaaaataa

DBGET integrated database retrieval system