KEGG   Listeria monocytogenes FSL R2-561: LMKG_02974Help
Entry
LMKG_02974        CDS       T01985                                 

Definition
(GenBank) asparagine synthetase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
lmg00250  Alanine, aspartate and glutamate metabolism
lmg01100  Metabolic pathways
lmg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMKG_02974
Enzymes [BR:lmg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     LMKG_02974
Peptidases [BR:lmg01002]
 Cysteine Peptidases
  Family C44
   LMKG_02974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC DUF3700 NAD_synthase
Motif
Other DBs
NCBI-ProteinID: AEO26010
Position
complement(1733612..1735477)
Genome map
AA seq 621 aa AA seqDB search
MCGFVGCVHDRITEITGADKETFRQMNSMITHRGPDDEGYFTDDHVQFGFRRLSIIDVEN
GHQPLTYENERYWIIFNGEVYNYVELREQLVAEGMTFETESDTEVIIATYAKYKEKTAER
LRGMFGFVIWDKQEELVYGARDPFGIKPFFYAEEDDKLFMGSEKKSILHALKEKELDEVS
LQNYMTYQFVPEPDSLTKNVKRLEPGHQFTKKIGQPMEITTYWKASFAPVTKSEDAWIKE
VRDVMYDSVKMHMRSDVPVGSFLSGGIDSSIIAAIAKEYHPAIKTFSVGFERDGFSEIDV
AKETADKLGVENISYVISPEEYMKELPKIVWHMDDPLADPAAIPLYFLSREARKQVTVAL
SGEGADELFGGYNIYNEPNSLAMFNKMPGVFKSMLNNLARIMPEGMRGKSFLERGTTPME
ERYIGNAKMFTEKEKQILLPKYQAGHDYTNITDPFYAETTNYHPVERMQYIDIHTWLRGD
ILLKADRMTMANSLEVRVPFLDKEVYNVARNIPDTMKTTNGTTKYILRKAAATFVPEHVL
NRRKLGFPVPIRHWLKDEMNAWVKNIIKESPTDHLINKQYVLDLLDDHCAGKFDYSRKIW
TVVIFMIWYDVYVADKYDFGK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatttgtaggatgcgtacatgaccgcattacagaaattactggcgctgataaa
gaaacctttagacaaatgaacagtatgattacgcaccgtgggccagatgatgaaggatac
ttcacagatgatcacgtgcagtttggtttccgccgtttaagtattattgatgtagaaaac
ggtcatcaaccgttaacgtatgaaaatgaacgttactggattatttttaatggagaagtt
tataactatgtggaactccgcgagcaattagttgctgaaggaatgacatttgaaaccgaa
agtgataccgaagtaattatcgctacatatgcgaaatacaaagaaaaaacagcagaacgc
cttcgcgggatgtttggttttgttatttgggacaaacaagaagaacttgtttacggcgca
cgcgacccattcggcattaaaccatttttctatgcagaagaagacgacaagctgttcatg
ggttctgaaaagaaatccattttacatgcgttaaaagaaaaagaattggacgaagtgtca
ttacaaaactatatgacttaccaatttgttccagaaccagattccttaactaaaaatgtc
aaacgtttagagccaggacatcagtttacgaaaaaaattggtcaaccgatggaaattacg
acttattggaaagcatcttttgcaccagtaactaaatcagaagacgcatggattaaagaa
gtgcgtgacgtgatgtatgattctgttaaaatgcacatgcgctctgatgtgccagttggt
tcattcctatctggcggtattgattcatcgattattgcagcaattgccaaagaataccac
ccagcaatcaaaacattctcagttggttttgaacgcgatggtttcagtgaaatcgatgta
gcaaaagaaacagcggacaaacttggcgtagaaaacattagttatgttatctcaccagaa
gaatatatgaaagaactaccgaaaattgtttggcacatggatgatccacttgctgacccg
gctgctattccgctttatttcttatcaagagaagcgcgcaaacaagtaaccgtagcatta
tcaggtgaaggcgcagatgaacttttcggtggttataacatttataacgaaccaaattcc
cttgcaatgtttaacaaaatgccaggcgtatttaaatcaatgttaaataacttggcgcgt
attatgccagaaggaatgcgtggtaaaagtttcttagaacgtggaacaacgccgatggaa
gaacgttatatcggaaacgccaaaatgttcacggaaaaagaaaaacaaattttacttcca
aaatatcaagctggtcatgactatacgaatattacagatccattttatgcagaaacaacg
aattatcatcctgtagaaagaatgcagtacattgatattcatacgtggcttcgcggagat
attcttctcaaagctgaccgcatgacgatggctaattcgctggaagtccgtgtacctttc
cttgataaagaagtgtacaacgtggcaagaaatattccagatacaatgaaaacaactaat
ggaactactaaatatatcttacgtaaagcggcagcaacatttgtaccagaacatgtactt
aatcgccgtaaactaggattcccagtaccaattcgtcactggttaaaagacgaaatgaac
gcttgggttaaaaatatcattaaagaatcaccaaccgatcatttaattaacaaacaatac
gtgctagacttactagacgatcactgtgccggtaaattcgactacagtcgtaaaatctgg
acagtcgttattttcatgatttggtacgatgtatacgtagcagacaaatacgattttgga
aaataa

DBGET integrated database retrieval system