KEGG   Listeria monocytogenes FSL R2-561: LMKG_03127Help
Entry
LMKG_03127        CDS       T01985                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lmg  Listeria monocytogenes FSL R2-561
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LMKG_03127
Enzymes [BR:lmg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     LMKG_03127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
232608..233393
Genome map
AA seq 261 aa AA seqDB search
MVMGILNVTPDSFSDGGKYMQVEEAVARALQMAEDGAAIIDVGGISTRPGFSEVTPDEEL
ARIIPVIKAVRTKLPDIWISVDSWRAEVAEQAILAGADMINDQWGAKKEPKIAEVAAKYD
VPICLMHNRENAQYDNFLEDVKKDLLESIAIAKAASVPDEHIILDPGFGFVKTPAQNLEV
LRRIDEIVALGYEVLLGTSRKSTIGLVLGTTPGDRMEGTGATTVYGFSKGCTITRVHDVL
PIARMVRMTDAITGKLDITNL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggtcatggggatattgaatgttacgccagattctttttcagatggcgggaaatatatg
caagtagaagaagcggtggctcgagcgttacaaatggcggaagatggagcagcgattatt
gacgttggaggaatatctactcgtcctggtttttcggaagtaacccccgatgaagaactt
gcccgaattataccggtcattaaagctgtcaggacgaaattacccgatatatggatttcc
gttgattcttggcgtgctgaagtagcggaacaggctatcttagcgggagctgatatgata
aatgaccagtggggtgcgaaaaaagaaccgaaaattgccgaagttgctgcaaaatacgat
gtaccgatttgtttaatgcacaatcgtgagaacgcgcaatacgacaattttttagaagat
gtgaaaaaagacttgttagaaagtattgccatagctaaagcagcatcagtaccagacgag
catattattctcgatccaggttttggttttgttaagacacctgctcagaatttagaagtg
ttacgacggattgatgagatagtcgcacttggttacgaggttttactcggtacgagcagg
aagtcaactattgggcttgtcctaggaactactcctggagatagaatggaaggaactgga
gcaacaactgtctatggattttcgaaaggttgtacaattactcgtgtccatgatgtactt
ccaattgcacgtatggtgcgaatgacagatgcaatcactggcaaattagatattacaaat
ttataa

DBGET integrated database retrieval system