KEGG   Listeria monocytogenes HCC23: LMHCC_0022Help
Entry
LMHCC_0022        CDS       T00801                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:lmh00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
22706..23338
Genome map
AA seq 210 aa AA seqDB search
MKIAAFDIDAQKGFTPLCPDELPVSGGDKIVPELNFMASLASIRIGSKDAHPQNAVWVVD
SKDEMLAKLEYPNADRTWVRHCEPGTKGFELLDGLPVVTDYDYFIWKGMEPDIHPYGACY
HDIVEQLSTGVLEYLREQKVDLVLVGGLAFDFCVKTTVIQLSRAGFSVLVYLPATRALSE
QGFDETKEQLANTEKVQLIETREELVAYCQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgccgcttttgatattgatgcacaaaaaggctttacaccgctttgtcccgat
gaattaccggtttcgggcggagacaaaattgtgccagaacttaattttatggcaagcctt
gcttctattcgaattggtagtaaagatgcgcatccgcaaaatgctgtatgggtagttgat
tccaaagacgaaatgctggctaaactcgaatatccaaatgcagaccgtacttgggtaagg
cactgtgaaccaggtacaaaaggttttgaattattagatggtttaccagttgtgactgat
tatgattactttatttggaaaggtatggagccggacattcatccgtacggcgcttgttac
cacgatattgtcgaacagctttcaactggagtacttgagtatttacgcgaacaaaaagtt
gatttagttcttgttggaggtttagcttttgatttttgtgtgaaaactacggttatacag
ttaagtagggcaggcttttctgtattagtttatttaccagcgacacgtgcattatctgaa
caaggttttgatgaaacaaaagagcaattagcaaataccgagaaagtgcaacttatcgaa
acaagggaggaacttgtcgcctattgccagtaa

DBGET integrated database retrieval system