KEGG   Listeria monocytogenes HCC23: LMHCC_0124Help
Entry
LMHCC_0124        CDS       T00801                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmh00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lmh00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
118682..119743
Genome map
AA seq 353 aa AA seqDB search
MVFIEVIQEQFGEFEGKTVWQWTMVNDHGMRMSVLNYGAIVTSLETKDKFGNLANISLGF
TNLDDYLAHSPYFGATLGPVAGRISNGQFKLDGKQFQLTQNEGTNHRHGGKLNFSKKIWN
VTVEKELDQIVMTFDYCWADGENGYPGNINARMTYTLNNKNEWLIDYEAKSDKPTIYNPS
NHIYFNLSGETGSTVLQHQLWINSDRFLPIDGESIPIGEKRSVENTIFDLRAGRELAEIT
QSQDQQIKLVGAGLDHAFILKHENGRPDAVLFDPQSGRRLEMETESDSVLVYTANSLDST
FEIDGRAGPKYAGITMETQGLVDAINQDGFGDIVLRPEKPFTSRTAFRFTAES
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtggttttcatcgaagtaatccaggaacaatttggtgaatttgaaggaaaaacggtctgg
caatggacgatggtaaatgaccatggtatgcgcatgagcgtattaaattacggagcgatt
gttacttccctagaaacgaaagataaatttggcaatttggcgaatattagtcttggtttt
acgaatctagatgattatttagcacattcgccatactttggtgcgacgcttggtccagtt
gctggtcgtattagtaatgggcaatttaagctagacgggaaacagttccaactgactcaa
aatgaagggactaaccaccggcatggaggcaaacttaattttagtaagaagatttggaat
gtaactgtggaaaaagagcttgatcaaattgtgatgacttttgactattgctgggctgac
ggagaaaatggctatccggggaatatcaatgctagaatgacttatactttaaataataaa
aatgaatggctaattgattatgaagcaaaaagcgacaagccgactatttataatccaagc
aatcatatttattttaatttgagtggagagactggttcgacagtgttacagcatcagctc
tggattaatagcgatagattcctgcctatagatggggagtctattccaataggtgaaaaa
cgttcagtggaaaatactatttttgatttgcgtgcaggtcgtgaattagcggagattacg
caaagtcaggaccagcaaataaaattagttggtgcggggctagatcatgcatttatttta
aaacacgaaaatggtcgtccggatgcagttttatttgatccacagtcaggacggcgcttg
gaaatggaaacggaatcggactctgtattagtatatacagcgaatagtttggatagtaca
ttcgagatagacgggcgggctgggccaaaatatgctggtataacgatggagacgcaaggt
ttggtggatgcgattaatcaagatggatttggagatattgtactgcgaccagaaaaacct
ttcacatctaggacggcttttcgtttcactgcggagagctga

DBGET integrated database retrieval system