KEGG   Listeria monocytogenes HCC23: LMHCC_0337Help
Entry
LMHCC_0337        CDS       T00801                                 

Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMHCC_0337
   01230 Biosynthesis of amino acids
    LMHCC_0337
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMHCC_0337
  Energy metabolism
   00680 Methane metabolism
    LMHCC_0337
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMHCC_0337
Enzymes [BR:lmh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LMHCC_0337
Exosome [BR:lmh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LMHCC_0337
  Exosomal proteins of melanoma cells
   LMHCC_0337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
340446..341135
Genome map
AA seq 229 aa AA seqDB search
MKLVLIRHGQSEWNKLNLFTGWHDVDLSQEGVVEAMTAGKRIKEAGLEFDVAFTSVLTRA
IKTLNYVLEESDQMWVPVHKSWRLNERHYGALQGLNKQETAEKYGADQVQKWRRSYDTLP
PLLEENDERQAKNDRRYQLLDTHAIPSGENLKVTLERVIPYWMDTIAPEIKEGRRVVIAA
HGNSLRALVKFLEGISDDEIMDLEIPTGVPLVYELNDDLKPVNKYYLDK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtattaattcgtcatggtcaaagtgaatggaacaaattgaatttatttaca
ggttggcatgatgttgacttgtcacaagaaggcgttgtagaagcaatgactgcaggtaaa
agaattaaagaagcgggcttagaattcgatgttgcctttacttccgttttaacgcgagct
attaaaacactcaattacgtgttagaagaatcggatcaaatgtgggttccagttcataaa
tcttggcgtttgaacgaacggcattacggagcactccaagggctcaataaacaagaaact
gctgaaaaatacggtgctgaccaagtacaaaaatggcgtagaagctatgatactcttcca
ccattactagaagaaaacgacgaaagacaagcaaaaaacgatcgccgttatcaattactt
gatacacatgcgattccttcaggtgaaaacttaaaagtaacgttagaacgagtaattcct
tattggatggataccattgctccagaaattaaagaaggtcgccgggtagtcatagcggct
catggtaatagtttacgagcattagtgaaattcctagaaggtattagcgatgatgagata
atggacttagaaattccaacaggcgtaccacttgtatatgaattgaatgatgatttaaaa
ccagtaaataaatattacttggataaataa

DBGET integrated database retrieval system