KEGG   Listeria monocytogenes HCC23: LMHCC_0718Help
Entry
LMHCC_0718        CDS       T00801                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LMHCC_0718 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LMHCC_0718 (pyrB)
Enzymes [BR:lmh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     LMHCC_0718 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
728136..729047
Genome map
AA seq 303 aa AA seqDB search
MKNLLSMEALTVHEIEHLLGQAAQFKRGKKATFTEQAFAVNMFFEPSTRTHTSFEVAEKK
LGVEVVSFDAASSSMTKGETLYDTLLTMQAVGVNVAVIRHSEENYYEGLENLDIAIVNGG
DGCGEHPSQSLLDLFTIKEQFGTFQGLKVAIAGDIRHSRVANSNMKVLKRLGAELFFSGP
REWFDESCLAYGTYLPVDEMVEKVDVMMLLRVQHERHSGTEAFTKESYHEKFGLTIERAA
KLKADAIIMHPSPVNRDVEIADSLVESEKSRIVTQMTNGVFIRMAILEAILKEQEMRAKL
CTY
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttgttgtcaatggaagcattaaccgtccatgaaatcgagcatttattaggg
caggcggcacagtttaaacgcgggaaaaaagcaacttttacggaacaagctttcgcggtc
aatatgttttttgaaccaagtacgagaacacatacgagttttgaagtagcggagaaaaag
ttaggagtcgaggtggtttcctttgatgctgcgagctctagcatgactaaaggggagacg
ctctacgacaccctgctcaccatgcaagcagttggagtgaatgtggcagtaatcaggcat
tcagaagaaaactattacgagggtcttgaaaacttagatattgctattgtaaacggcggg
gatggctgtggggaacatccgagccaatcattactcgacttatttacgataaaggagcaa
tttggtacttttcaaggattgaaagtagcgattgctggtgatatcaggcacagccgagtc
gcgaattccaatatgaaagtgctaaaaagacttggagcggaactgtttttctcgggaccg
agagaatggtttgacgaaagttgcttagcatatggcacctacttgccggtcgatgagatg
gtagaaaaagttgatgtgatgatgctattacgggtacaacatgagcgccatagtggaaca
gaggcgtttacgaaagaaagctatcacgaaaaatttggtttaacgattgagcgggcggca
aagctaaaagcagatgcgattattatgcacccaagccctgtaaaccgagatgtggaaatc
gctgatagcttagttgaaagcgaaaaatcacgcattgttacgcaaatgacaaatggcgtt
tttataagaatggccattttggaagctattttaaaagaacaggaaatgagggcgaaatta
tgtacgtattaa

DBGET integrated database retrieval system