KEGG   Listeria monocytogenes HCC23: LMHCC_0902Help
Entry
LMHCC_0902        CDS       T00801                                 

Gene name
asnB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lmh00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
924152..926017
Genome map
AA seq 621 aa AA seqDB search
MCGFVGCVHDRITEITGADKETFRQMNSMITHRGPDDEGYFTDDHVQFGFRRLSIIDVEN
GHQPLTYENERYWIIFNGEVYNYVELREQLVAEGMTFETESDTEVIIATYAKYKEKTAER
LRGMFGFVIWDKQEELVYGARDPFGIKPFFYAEEDGKLFMGSEKKSILHALKEKELDEVS
LQNYMTYQFVPEPDSLTKNVKRLEPGHQFTKKIGQPMEITTYWKASFAPVTKSEDAWIKE
VRDVMYDSVKMHMRSDVPVGSFLSGGIDSSIIAAIAKEYHPAIKTFSVGFERDGFSEIDV
AKETADKLGVENISYVISPEEYMKELPKIVWHMDDPLADPAAIPLYFLSREARKQVTVAL
SGEGADELFGGYNIYNEPNSLAMFNKMPGVFKSMLNSVARIMPEGMRGKSFLERGTTPME
ERYIGNAKMFTEKEKQILLPKYQAGHDYTNITDPFYAETTNYHPVERMQYIDIHTWLRGD
ILLKADRMTMANSLEVRVPFLDKEVYNVARNIPDTMKTTNGTTKYILRKAAATFVPEHVL
NRRKLGFPVPIRHWLKDEMNAWVKNIIKESPTDHLINKQYVLDLLDDHCAGKFDYSRKIW
TVVIFMIWYDVYVADKYDFGK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatttgtaggatgcgtacatgaccgcattacagaaattactggcgctgataaa
gaaacctttagacaaatgaatagtatgattacgcaccgtgggccagatgatgaaggatac
ttcacagatgatcacgtgcagtttggtttccgccgtttaagtattattgatgtagaaaac
ggtcatcaaccgttaacgtatgaaaatgaacgttactggattatttttaatggagaagtt
tataactatgtggaactccgcgagcaattagttgctgaaggaatgacatttgaaaccgaa
agtgataccgaagtaattatcgctacatatgcgaaatacaaagaaaaaacagcagaacgt
cttcgtgggatgtttggtttcgttatttgggataaacaagaagaacttgtttacggcgca
cgcgacccatttggcattaaaccatttttctatgcagaagaagacggcaaattgttcatg
ggttctgaaaagaaatccattttacatgctttaaaagaaaaagaattagatgaagtttca
ttacaaaactatatgacttatcaattcgttccagaaccagattccttaactaaaaatgta
aaacgtttagaaccaggacatcagttcacgaagaaaattggtcaaccaatggaaattact
acttattggaaagcatcttttgcaccagtaactaaatcagaagacgcatggattaaagaa
gtgcgtgacgtaatgtacgattctgtaaaaatgcatatgcgctctgatgtaccagttggt
tcattcctatccggtggtattgattcatcgattattgctgcgattgctaaagaatatcat
ccagcaattaaaacattctctgttggttttgaacgcgatggtttcagtgaaatcgatgtc
gcaaaagaaacagcagacaaacttggcgtagaaaacattagttatgttatttcaccggaa
gaatatatgaaagaattaccaaaaattgtttggcatatggatgatccacttgctgatccg
gctgctattccgctttacttcttatcaagagaagcgcgcaaacaagtaacggttgcattg
tccggtgagggggcagatgaacttttcggtggttataacatttataacgaaccaaattcc
cttgcgatgtttaacaaaatgccaggcgtatttaaatcaatgttaaatagcgtggcgcgt
attatgccagaaggtatgcgtggtaaaagtttcttagaacgtggaactactccgatggaa
gaacgctatatcggaaacgcgaaaatgttcacggaaaaagaaaaacaaattttacttccc
aaataccaagctggacatgattatacgaacattacagatccattttatgcggaaacaacg
aattatcatcctgtagaaagaatgcagtatattgatattcatacgtggcttcgtggcgat
attctcttaaaagctgaccgcatgacaatggctaattcactggaagtccgtgtacctttc
cttgataaagaagtgtacaatgtggcaagaaatattccagatacaatgaaaacaaccaac
ggaactactaaatatatcttacgtaaagcggcagcaacatttgtaccagaacatgtactt
aatcgtcgtaaactaggattcccagtaccaattcgtcactggttaaaagacgaaatgaac
gcttgggttaaaaatatcattaaagaatcaccaaccgatcatttaattaacaaacaatac
gtgctagacttactagacgatcactgtgccggtaaattcgactacagtcgtaaaatctgg
acagttgttattttcatgatttggtacgatgtatacgtagcagacaaatacgactttgga
aaataa

DBGET integrated database retrieval system