KEGG   Listeria monocytogenes HCC23: LMHCC_0998Help
Entry
LMHCC_0998        CDS       T00801                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
lmh00010  Glycolysis / Gluconeogenesis
lmh00030  Pentose phosphate pathway
lmh00051  Fructose and mannose metabolism
lmh00052  Galactose metabolism
lmh00680  Methane metabolism
lmh01100  Metabolic pathways
lmh01110  Biosynthesis of secondary metabolites
lmh01120  Microbial metabolism in diverse environments
lmh01130  Biosynthesis of antibiotics
lmh01200  Carbon metabolism
lmh01230  Biosynthesis of amino acids
lmh03018  RNA degradation
Module
lmh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMHCC_0998 (pfkA)
   00030 Pentose phosphate pathway
    LMHCC_0998 (pfkA)
   00051 Fructose and mannose metabolism
    LMHCC_0998 (pfkA)
   00052 Galactose metabolism
    LMHCC_0998 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    LMHCC_0998 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LMHCC_0998 (pfkA)
Enzymes [BR:lmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LMHCC_0998 (pfkA)
Protein phosphatases and associated proteins [BR:lmh01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LMHCC_0998 (pfkA)
Messenger RNA biogenesis [BR:lmh03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LMHCC_0998 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ACK39346
UniProt: B8DHH7
Position
1029509..1030468
Genome map
AA seq 319 aa AA seqDB search
MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDL
LHRGGTFLYSARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTI
GIPGTIDNDISGTDFTIGFDTALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWS
GLAGGAEAIIVPEESFNMDDVVDRLNKGRERGKKHSIIVVAEGVMSGNEFAKQLAEYGDY
HARVTVLGHVQRGGSPTAFDRVLASRLGARSVELLLEKRGGLAVGIRENRIVENDISEIL
KEKHTLDQKLFDLASILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgcaattttaacaagtggaggagacgctccaggaatgaatgcagccact
cgtgctgttgtacggaaagcaatctatgaaggacttgaagtttacggtattaactatggc
tttttagggctagtcaatggcgatattcgtaaactagaattaggttctgttggtgattta
cttcaccgcgggggtacattcctttattccgcaagatatcctgaattcgctacagaagaa
ggacaacttaaaggaattgaacaattgaaaaaacatcaaatcgatggcctagttgttatc
ggtggagatggttcttatcacggagcggaagcacttacaaaacgtggattcccaactatt
ggtatcccaggaacaattgataatgatatttctggaactgattttactattggttttgat
actgcattaaacactgttcttgatgcacttgataaaatccgcgatacagctacaagtcat
gaacgtactttcattattgaagttatgggtcgtgatgctggtgatatcgctctttggtct
ggacttgctggtggcgctgaagctatcatcgttccagaagaaagctttaatatggatgat
gtcgtggatcgtttgaacaaaggtcgcgaacgtggtaaaaaacatagtattatcgtcgtt
gctgagggcgtaatgtctggtaatgaattcgctaaacaattagctgaatatggcgattat
catgcacgtgtaactgttcttggacacgttcaacgtggtggtagcccaactgcatttgac
cgtgtacttgcaagccgtcttggtgcgcgttcagtagaattattgttagaaaaacgcgga
ggattagctgttggaatccgtgaaaatagaattgtcgaaaatgacattagtgaaattttg
aaagaaaaacacacacttgatcaaaaattatttgatctagcatctattttgtcgatttaa

DBGET integrated database retrieval system