KEGG   Listeria monocytogenes HCC23: LMHCC_1015Help
Entry
LMHCC_1015        CDS       T00801                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lmh00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1049226..1050200
Genome map
AA seq 324 aa AA seqDB search
MKNQFDRHRRLRKTKTMRDLVRETVLHTDDLIYPIFVKDGKEPKTEVVSMPGVFQFPLHE
LEEEMRTVENLGIKAVILFGIPAEKDAVGTQAYHDHGIIQEATRLIKKCFPEILVVADTC
LCEFTDHGHCGVIENGEILNDESLDLLKQTAVSQAKAGADIIAPSNMMDGFVQVIREGLD
EAGFYDIPIMSYAVKYASAFYGPFRDAAESAPQFGDRKSYQMDPANREEALREAISDEQE
GADFLIVKPSLSYLDIMRDVKNNTNLPVVAYNVSGEYAMVKAAAQNGWIDEEKIVLEMLT
SMKRAGATLIITYFAKDVSKYLNK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaatttgatagacaccgtcgcctaagaaaaaccaaaacaatgcgtgattta
gtgagagaaacagttttacatacagatgatttaatctatccgatttttgtcaaagatggt
aaagaaccaaaaacagaagtagtttccatgccaggcgttttccaatttcctctgcacgaa
ctagaagaagaaatgcgcaccgtagagaaccttggtattaaagcagttattttatttgga
atccctgccgaaaaagacgcagttgggacacaggcttaccacgatcacggaattatccaa
gaagccacaagacttattaaaaaatgctttcctgaaatcctcgttgtagccgatacttgt
ttatgtgaattcactgaccatggacattgtggtgttattgaaaatggtgaaattctaaat
gacgaatcactagatttattaaaacaaacagctgttagtcaagcgaaagcaggagcggac
atcattgcgccttctaatatgatggacggttttgttcaagtaatacgtgaagggcttgac
gaagcgggcttttatgatattccaattatgtcttatgccgttaaatatgcttctgctttt
tatgggcctttccgcgatgctgctgaaagtgcaccacaatttggcgatagaaaatcatat
caaatggaccctgctaaccgtgaagaggctcttcgtgaagcgatatctgatgaacaagag
ggagccgattttcttattgtaaaaccatccttatcttatttagatattatgcgcgatgtg
aagaacaataccaatttgccagtagtcgcttataatgttagtggtgaatatgcaatggta
aaagccgctgcacaaaatggttggatagatgaagaaaaaattgttttagaaatgctaact
agcatgaaacgcgcaggcgcaacacttatcattacctattttgcaaaagacgtttctaaa
tacttaaataaatag

DBGET integrated database retrieval system