KEGG   Listeria monocytogenes HCC23: LMHCC_1036Help
Entry
LMHCC_1036        CDS       T00801                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lmh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1071652..1072257
Genome map
AA seq 201 aa AA seqDB search
MYDYIKGTVTTITPEYIVVEAGQIGYQIITGNPFSFQRLEGTEAQVFLYQHVREDNISLF
GFQTTEERYLFKKLLSVSGIGPKSALAIIASGDVVPLISAIESEDDVYLTKFPSVGKKTA
RQIILDLKGKLADVVASEIVYVAPENDMVAGLSPQLEEAVLALEALGYSTRELKKVIPKL
AKEEDLTSDAYIKLALQLMTK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgattacataaaaggaaccgttacgacgattacacccgaatatattgttgtcgag
gcaggacaaatcggctatcaaataattacaggaaacccgttttcctttcaacgattagaa
ggtacagaagcgcaagtctttttgtatcaacatgtgcgggaggataatatttctctattc
ggttttcaaacaacagaagaacgttatttattcaaaaaattattgagtgtttcgggcatt
ggaccaaaaagcgcgttagctattattgcttcaggcgatgtcgttccactgatttctgct
attgaatccgaagacgatgtttatttaaccaaatttccaagtgttggtaaaaaaacagcg
cgccaaatcattctcgatttgaaaggcaagctggctgatgttgttgcaagtgaaattgtt
tatgttgcaccagaaaatgatatggttgctggactttctccgcaattagaagaagctgta
ttagctttagaagcgctcggttatagcacgcgagaacttaaaaaagtaataccaaaattg
gcaaaagaagaagacctaacaagcgacgcatatatcaagctagcactacaattaatgaca
aaatag

DBGET integrated database retrieval system