KEGG   Listeria monocytogenes HCC23: LMHCC_1036Help
Entry
LMHCC_1036        CDS       T00801                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LMHCC_1036 (ruvA)
Enzymes [BR:lmh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LMHCC_1036 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1071652..1072257
Genome map
AA seq 201 aa AA seqDB search
MYDYIKGTVTTITPEYIVVEAGQIGYQIITGNPFSFQRLEGTEAQVFLYQHVREDNISLF
GFQTTEERYLFKKLLSVSGIGPKSALAIIASGDVVPLISAIESEDDVYLTKFPSVGKKTA
RQIILDLKGKLADVVASEIVYVAPENDMVAGLSPQLEEAVLALEALGYSTRELKKVIPKL
AKEEDLTSDAYIKLALQLMTK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgattacataaaaggaaccgttacgacgattacacccgaatatattgttgtcgag
gcaggacaaatcggctatcaaataattacaggaaacccgttttcctttcaacgattagaa
ggtacagaagcgcaagtctttttgtatcaacatgtgcgggaggataatatttctctattc
ggttttcaaacaacagaagaacgttatttattcaaaaaattattgagtgtttcgggcatt
ggaccaaaaagcgcgttagctattattgcttcaggcgatgtcgttccactgatttctgct
attgaatccgaagacgatgtttatttaaccaaatttccaagtgttggtaaaaaaacagcg
cgccaaatcattctcgatttgaaaggcaagctggctgatgttgttgcaagtgaaattgtt
tatgttgcaccagaaaatgatatggttgctggactttctccgcaattagaagaagctgta
ttagctttagaagcgctcggttatagcacgcgagaacttaaaaaagtaataccaaaattg
gcaaaagaagaagacctaacaagcgacgcatatatcaagctagcactacaattaatgaca
aaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system