KEGG   Listeria monocytogenes HCC23: LMHCC_1060Help
Entry
LMHCC_1060        CDS       T00801                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LMHCC_1060
Enzymes [BR:lmh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LMHCC_1060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1098298..1100694
Genome map
AA seq 798 aa AA seqDB search
MAEQESLALFNDTPEELFMKGTMLSTIFYNAENLFSVVRILVKETNADWDEKDIIVTGFF
PALHEQEVYTFYGKMQEHAKFGQQFKADRFRKEMPQSRAGLISYLSGELFKGIGKVTAEN
IVDTIGDDAITKILSDPSLLNTVPKLPSGAAESLLASLRENQGLEHVMVGLNEYGFGPQL
SMKIFQAYKQNAIEVLENNPYKLIEDVKGIGFHRADELGRKLGLGGNHPERLRAGILFML
DSVCMQQGHVYMEQEVLLGEVTYLLEESEGIRIDQNILVAQVEKLAEEQKIITENTRVYM
PSLYYSESGFAYHVKRMLKQTEYQEQFPQSEFLLALGELEERIGVHYGDSQRQALEQALM
SPMLVLTGGPGTGKTTVIKGIVELYAELNGVSLDPHAYKDGATFPVLLAAPTGRAAKRMS
ESTGLPAMTIHRLLGMNGQEQMDDDAERLIDGRLLIVDEMSMVDIWLANQLFRALPAHMQ
VVLVGDQDQLPSVGPGQVLKDILQSEQIPTVALSDIYRQKDGSSIIEMAHYIKEGMLPAD
FTKNSADRSFFHCTVNQIGDVVEQVVKNAKNKGFRAKDIQVLAPMYRGPAGIDVLNKKLQ
EIFNPNDTGRRKEVQFGEIKYRVHDKVLQLINQPEKNVFNGDIGEIVSIIYAKENTEKQD
LIVVQFDQTEVSYYRQEFNQLTHAYCCSIHKAQGSEFPIVIMPIVRSYYRMLRRDLLYTG
VTRSKQFLILCGEEEAFRMGIERIDENKRNTTLSERLMSEDVLLEQMTNKRILTAENITE
IDPMIGMEGITPEQFMAG
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaagaatcactcgctctatttaacgatacaccagaagaacttttcatgaag
ggcacgatgttgtccaccattttttacaatgccgaaaacctcttttctgttgtacgaata
ttggtcaaagaaaccaatgcggattgggacgaaaaagatattatcgtaactggctttttc
ccagcgcttcacgagcaagaagtgtacactttctacggaaaaatgcaggaacatgctaaa
tttggtcaacagtttaaagcagaccgatttcgtaaggaaatgccacaatcacgagcgggt
ttaattagttatctatctggtgaactttttaaaggcattggtaaagtcactgctgaaaat
attgtggatacgattggcgacgatgctatcacaaaaattttatccgatccgagcttgcta
aatacagtacctaagttgccatctggcgcggcagaaagtttgcttgcttcccttagagaa
aatcaagggttggagcatgtgatggtcggattaaacgaatatggctttggtccacaatta
tccatgaaaatttttcaggcttataaacaaaatgcgattgaagtattagaaaataacccc
tataaattaattgaagacgtaaaagggattggttttcatcgtgccgacgaacttgggcgg
aaactaggtcttggcgggaatcatccagaacggcttcgtgctgggattttatttatgtta
gattcggtttgtatgcaacaaggtcatgtatatatggagcaagaggttctgctcggagaa
gtaacttatttactggaagaaagcgaaggcattcgtattgaccaaaatattttagtggct
caagtagaaaaattagccgaggaacaaaagattatcacggaaaatacacgtgtttacatg
ccatcgctctattattcagagagcggctttgcatatcacgtgaagcgaatgcttaaacaa
acagaataccaagaacaatttccgcaatctgaatttctgctagctctaggtgaattagaa
gaacggattggagttcactacggagattctcaacgtcaggcgttagaacaagcgttaatg
tctccgatgctcgtacttactggtggtcccggaacagggaaaacaacagttattaaaggg
atagtagagttgtatgcggagctaaatggtgtaagtcttgatccgcatgcctataaagat
ggagcaacgtttcctgtgcttcttgccgctccaacaggtcgcgctgctaaacgaatgtca
gaatcaactggacttccggcgatgactattcaccgtctgcttggaatgaacggtcaggaa
caaatggatgatgatgcagagcggcttattgatggacgactattgattgtagatgagatg
tcgatggttgatatttggcttgctaaccaattatttcgtgctttaccagcgcatatgcaa
gtcgtactcgttggtgaccaagatcaattgccgtctgttggaccaggtcaagtactcaaa
gatattcttcaatcagaacaaattccaaccgtagccctttcagatatttatcgccaaaag
gatggctcatccattatcgaaatggcgcattatataaaagagggaatgttgccagctgat
ttcaccaaaaatagcgccgatcgctcttttttccattgtacggtaaaccaaattggcgat
gtagtcgaacaagtggtgaaaaatgccaaaaacaaaggatttcgagcaaaagatatccaa
gttttagcgccgatgtatcgcggtccagcagggattgacgttttaaataaaaaactacaa
gaaatcttcaatccaaatgataccggtcgtcggaaagaagttcaatttggcgaaataaaa
tatcgcgtgcatgataaagtacttcaattaattaaccaaccggaaaagaatgtgtttaat
ggggacataggtgaaattgtgtctattatctatgcgaaagaaaataccgaaaaacaagat
ttgattgtcgttcaatttgaccaaacagaggtttcttactatagacaagaatttaatcaa
ttgacccatgcttactgttgttcgattcataaagcacagggaagtgaatttccgatagtg
attatgccgattgttcgcagttattaccggatgctacgccgcgatttactttacacaggg
gtaacgaggagtaaacagtttcttattctttgcggggaagaagaagcatttcgaatgggg
atagaacgaattgatgaaaataagcgcaatacaacactctctgaacgtttaatgagcgaa
gatgtattattagagcaaatgacgaataaacgaattcttactgctgaaaatattactgaa
atagatccgatgattggaatggaagggattacgccagaacaatttatggcaggatga

DBGET integrated database retrieval system