KEGG   Listeria monocytogenes HCC23: LMHCC_1154Help
Entry
LMHCC_1154        CDS       T00801                                 

Definition
(GenBank) acetyl-CoA acetyltransferase (Acetoacetyl-CoA thiolase)
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMHCC_1154
   00630 Glyoxylate and dicarboxylate metabolism
    LMHCC_1154
   00640 Propanoate metabolism
    LMHCC_1154
   00650 Butanoate metabolism
    LMHCC_1154
  Lipid metabolism
   00071 Fatty acid degradation
    LMHCC_1154
   00072 Synthesis and degradation of ketone bodies
    LMHCC_1154
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMHCC_1154
   00310 Lysine degradation
    LMHCC_1154
   00380 Tryptophan metabolism
    LMHCC_1154
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMHCC_1154
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMHCC_1154
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LMHCC_1154
Enzymes [BR:lmh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMHCC_1154
Exosome [BR:lmh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMHCC_1154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1193694..1194863
Genome map
AA seq 389 aa AA seqDB search
MNEVVIIDAVRTPIGKFGGSLKDISAVELGATALKGVLERANIAPDRVDQVIFGNVLQAG
LGQNVARQVAIKAGIPYKVPGVTINEVCGSGLKSIMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEIDPKNLRNSMLIDGLTDVYGDYHMGITAENVAEKFSVTREEQDKFAH
NSQMKAASAQEKNLFEEEIIPVKLADGSFFEADETIRANSTLEKLATLKSVFKEDGTVTA
GNASGINDGASALILMSKEKAIAENIPFIATIKVTSEVGVDPAYMGYAPYYAVNEALTKG
GYSIDDIDLFHLNEAFASQSVAVARDLKIPEDKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHLGVASLCIGGGIGIAIIVERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtagttataatagatgcagttagaacaccaattggaaaattcggtggcagt
ttgaaagacatcagtgcagtagaacttggcgctaccgctctaaaaggcgtattagaaaga
gccaacattgctccagaccgcgtagatcaagttatttttggtaacgttttacaagcaggt
ctcggtcaaaacgtagctagacaagtcgctattaaagcaggaattccttataaagtacct
ggagtcacaatcaatgaagtttgtggatctggtttaaaatcgattatgcttggaagacaa
gcgatccaattaggcgaggccgacattgtagcagtgggagggaccgaaaacatgtctcaa
gcaccactattacttaatccggaactagccggcgaagaaattgatcccaaaaacttaaga
aatagcatgttaattgatggtttaacggatgtgtacggcgattatcatatgggaattaca
gccgaaaatgtggcagaaaaattctctgtaacccgagaagagcaagataaatttgcacat
aactcccaaatgaaagcagcaagtgcacaagaaaaaaacctttttgaagaagaaattatt
ccagtgaaacttgcagatggttcgtttttcgaagccgatgaaacgattcgtgcgaattcc
actttagaaaaactagctacattaaaaagcgtatttaaagaagatggaacagtcacagct
ggtaatgcttccgggatcaatgacggagcttctgcgcttattttaatgtcgaaggaaaag
gccattgccgaaaatattccttttatcgcgacaatcaaagtaacttcagaagttggtgtt
gatccagcatatatgggttacgcgccttactatgcagtaaatgaagcattaactaaaggc
ggatattctatcgatgacattgatctatttcatttaaatgaagcttttgcatcacagtcg
gttgccgtagctcgtgatttgaaaattccagaagataaactgaatatttacggcggagca
attgcgttaggtcatccaatcggagcatccggagcacgcattattgcctccttattaaat
gagttaaaacacgaaaataaacatcttggcgtggcttccttatgtatcggcggcggtatt
ggaattgcaattattgtcgaaagagcttga

DBGET integrated database retrieval system