KEGG   Listeria monocytogenes HCC23: LMHCC_1232Help
Entry
LMHCC_1232        CDS       T00801                                 

Definition
(GenBank) glucokinase (Glucose kinase)
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
lmh00010  Glycolysis / Gluconeogenesis
lmh00052  Galactose metabolism
lmh00500  Starch and sucrose metabolism
lmh00520  Amino sugar and nucleotide sugar metabolism
lmh00521  Streptomycin biosynthesis
lmh01100  Metabolic pathways
lmh01110  Biosynthesis of secondary metabolites
lmh01120  Microbial metabolism in diverse environments
lmh01130  Biosynthesis of antibiotics
lmh01200  Carbon metabolism
Module
lmh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMHCC_1232
   00052 Galactose metabolism
    LMHCC_1232
   00500 Starch and sucrose metabolism
    LMHCC_1232
   00520 Amino sugar and nucleotide sugar metabolism
    LMHCC_1232
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    LMHCC_1232
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LMHCC_1232
Enzymes [BR:lmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LMHCC_1232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ACK39579
Position
complement(1272737..1273705)
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKEGDIEEKWTIDTNIEDKGAHIVKNIGDSINQKLTDLQL
DNDIFYGIGMGTPGTVNYETGTVKGAYNLGWAEEQNVSQDLENITGLKIILDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGIRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDLAKEYTGKSALKDAINNDETITSKLIFELGAEDDALANET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKTYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALPSED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcgggacaacagcaaaattagctatttta
acaaaagaaggcgacattgaagaaaaatggacaattgatacaaatattgaagataaaggt
gcccacattgttaaaaatattggcgactctatcaatcaaaaattaacagatttacaacta
gataatgatattttttacggtattggaatgggaaccccagggactgttaattatgaaact
ggtacagtcaaaggtgcttataacctaggttgggctgaagaacaaaatgttagtcaagat
ttagaaaatattactggtttaaaaatcatattagataatgatgctaatgttgctgctctt
ggtgaacgctggaaaggcgcaggcgaaggtggggctaatgtcgttttcgtaacacttgga
acaggcgttggcggcggaattttcgcagaaggcaaaattttacatggtattcgcggagca
gctggtgaaattggccatgtaacagtagttccggaaaacggttatgactgtacttgtggt
aaaaagggctgtttagaaactgtcgcatcagcaacaggaatcgttcgagtagcgaaagat
ttagcgaaagagtatacaggtaaatctgcgcttaaagatgcaataaacaacgatgaaaca
attacttctaaattgatttttgaactaggagcagaagatgatgctttagcaaatgaaacc
attgataaaatttctttctatttggcattagcgcttagtcacattggtaatatgttaaat
ccagagaaaattattatcggcggtggagtttcagcggctggcgaccaattattaacacca
gtaaaaacttattttgagacaatggttttcccggcggttaaagaatctactaaattatct
attgcgacaaaagggaatgacgcagggataatcggagccgcatggttagcactaccaagt
gaagattaa

DBGET integrated database retrieval system