KEGG   Listeria monocytogenes HCC23: LMHCC_1253Help
Entry
LMHCC_1253        CDS       T00801                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMHCC_1253 (dxr)
Enzymes [BR:lmh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     LMHCC_1253 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1296333..1297475)
Genome map
AA seq 380 aa AA seqDB search
MKKIILLGATGSIGTQTLAIIRENPEKFQVVALSFGRNMERGRAIIKEFKPKMVAVWHTR
DRVTLEAEFPNVKFFNGLEGLREVATYLDGDVLLNAVMGSVGLLPTLDAIEAGKAIAIAN
KETLVTAGHLVMRAAKEKNISLLPVDSEHSAILQALNGENTERIEKIVLTASGGSFRDKT
REQLSLVTVKEALKHPNWNMGNKLTIDSATMFNKGLEVMEAHWLFGVDYDDIEVVIQRES
IIHSMVQFVDGSFIAQLGTPDMRMPIQYALTYPDRLYIPYEKEFRITDFSALHFEKVDYE
RFPALKLAYNAGKIGGTMPTVLNAANEIAVAGFLNGQVAFYNIEALVENAMNRHTSISDP
DLDTILQVDQETRAYVKTLL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattttgctaggtgcaactggttctattggaacacaaacgcttgcaatc
attcgcgaaaatcctgaaaaatttcaagttgttgcgcttagttttgggcgtaatatggaa
cgtggtagggcgattataaaagagtttaaacccaaaatggtcgctgtttggcatacgaga
gatcgtgtgacattagaagcagaattcccaaacgtgaaattttttaatggtttagaaggg
cttagagaagtagcgacctatttagatggggatgtgcttttaaatgcagttatggggagc
gttggcttacttccaacattagatgcaatcgaagctgggaaggccattgcaattgctaat
aaagaaacgcttgttacggctggacatttagtcatgcgtgcggcgaaagaaaaaaacatt
tcactattacctgttgatagcgaacattctgctattttacaagcattaaacggagaaaat
acggaaagaatcgaaaaaatagttttgacagcgagcggtggaagtttccgagataagacg
agggagcaactcagcctggttacggtgaaagaagcgttaaaacatccgaactggaatatg
gggaataaattaacaattgattcagcaacgatgtttaacaaaggtttggaagtgatggag
gcgcactggctgtttggtgtggactacgatgatatagaagtcgttatccagcgcgaaagt
attatccattctatggttcagttcgtggatggaagtttcattgcgcaacttggtacacca
gatatgcggatgccaattcaatacgctttaacctatcccgacagactttatataccgtat
gaaaaagaattccggattactgatttttccgcacttcattttgaaaaagtggattatgaa
agatttccggcattgaaactcgcgtataatgctggtaaaataggtggaacaatgccgaca
gttttaaatgcagcaaatgaaattgctgttgctggctttttgaatggacaggtggctttt
tataatattgaagcacttgttgaaaatgcaatgaatcgtcatactagcatttctgaccct
gacttggataccattttacaagtcgatcaagaaacacgcgcgtatgtaaagacactttta
tag

DBGET integrated database retrieval system