KEGG   Listeria monocytogenes HCC23: LMHCC_1450Help
Entry
LMHCC_1450        CDS       T00801                                 

Definition
(GenBank) uroporphyrin-III C-methyltransferase/uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
lmh00860  Porphyrin and chlorophyll metabolism
lmh01100  Metabolic pathways
lmh01110  Biosynthesis of secondary metabolites
lmh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMHCC_1450
Enzymes [BR:lmh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     LMHCC_1450
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     LMHCC_1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4
Motif
Other DBs
NCBI-ProteinID: ACK39795
Position
complement(1470289..1471770)
Genome map
AA seq 493 aa AA seqDB search
MGKVMLIGAGPGDAQLLTVKGLAALRKADVIVYDRLVEPAMLQERKASCKLIYVGKEPLH
HPIPQEEIEQILVREAATNELVVRLKAGDPYVFGRGGEEGETLYKAGIPFEVIPGITSAI
GGLAYAGIPVTHRDFASSFHVITGHLKKGRDPLDWEALARLEGTLVFLMGMTNLPNICAN
LLENGRKAETGVAIVQWASRGKQLTVTGNLQNIEQKVAESGISSPALIVVGDVVSLRPQL
NFFEEMPLFHTKVLLPRARAGKSMLAEQIRDLGGEVTMYPNIQVVDVAPTKTREALIEIN
ELLFTSKEAVERFFDYLTKLDLDIRSLKNTHLTAIGKQTKEAFSEKGIIPDSFIKRRSTE
LILEHLPRLQKNASNLIIGSIVDTSEVNAILAEVEAMEMMPLYDMRPVTERPFDLASFEQ
VCFSSSRSVQNLLDVLTTEEKAILQTKTILSIGRFTSATLASFGINNFIEAESATPESLI
ELIQKTKLEGVPQ
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagtcatgttaattggtgcaggtcctggagatgcacagttgctaaccgtgaaa
ggcttagctgcactgcgaaaggcagatgttattgtatacgatcgcctcgttgaaccagcg
atgctccaagaacgaaaagctagttgtaaactcatttatgtcggaaaagaaccacttcat
catccaattccccaagaggaaatcgaacaaattcttgttagagaggctgcgacaaatgag
ctggttgttcgtctaaaagcaggagacccttatgtgtttggtcgcggcggggaagaagga
gagacactctataaagcgggaattccatttgaagttattcctggaatcacatccgcgatt
ggtgggcttgcctacgctggaattccagtaacccatcgtgattttgcttcgagttttcac
gtgattactggacatttgaaaaaaggacgtgatccactagattgggaagcccttgctaga
ctggaaggtacgctcgttttcctaatgggaatgactaatttacctaatatttgtgcgaac
ctactagaaaatggtcgaaaagccgaaacgggtgttgcgattgtacaatgggcatctcgc
ggcaaacaattaacggttaccgggaacttacaaaacatcgaacaaaaagtagcggagtct
ggtatttcttcgccggcacttattgtcgttggtgatgtggtgagcttacgaccacagctt
aacttctttgaggaaatgcctcttttccatacaaaagtattacttccaagagcacgagct
ggaaaaagtatgctcgcggaacaaattcgcgatttgggcggagaagtaactatgtatcca
aatattcaagtagtcgatgttgcgccaacgaaaacaagggaagcgctaatcgaaataaac
gaacttcttttcacatctaaagaagcggtagaacgatttttcgactatttaaccaagctt
gatttagatattcgttctctaaaaaatacccatcttactgctattggcaaacaaacaaaa
gaagcttttagtgaaaaaggaattattccagatagttttattaaaagacggagcacggaa
ttaattttggagcatttaccacggttacagaaaaatgcgagcaacttaattatcggaagc
atagttgatacgtcggaagttaacgcaattttagcagaagtggaagcgatggaaatgatg
ccgttatatgatatgcgtcctgtgacagaacgaccatttgaccttgcaagctttgaacaa
gtttgtttctcaagttcgcgttccgttcaaaatttactcgacgtactaacaaccgaagaa
aaagccattttacaaacgaaaacaattctttccattggaaggttcacgagcgcaacgtta
gcatcattcggtatcaacaactttatcgaagccgaaagcgccacaccagagagcttaatt
gaactaatccaaaaaacaaaattagaaggagtaccacaatga

DBGET integrated database retrieval system