KEGG   Listeria monocytogenes HCC23: LMHCC_1549Help
Entry
LMHCC_1549        CDS       T00801                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LMHCC_1549 (galU)
   00052 Galactose metabolism
    LMHCC_1549 (galU)
   00500 Starch and sucrose metabolism
    LMHCC_1549 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LMHCC_1549 (galU)
Enzymes [BR:lmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LMHCC_1549 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1555801..1556688
Genome map
AA seq 295 aa AA seqDB search
MRVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQYIVEEAVESGIEDILIVTGKGK
RAIEDHFDSVPELELNLREKNKLELLHLIEETTNINLHFIRQSKPKGLGDAILQARGFVG
NEPFIVMLGDDIVQAKTPCAKQLIDQYEKTHSSIIGVQTVPHEETYRYGIIDPIDEYSKN
LYNVNGFVEKPDPSAAPSDLAILGRYLLTPQIFDFLETQKPGAGGEIQLTDAINSLNEIQ
RVFAYDFEGERFDVGDKFGFIKTTMQFALKHPEIKDDVALLVDELYAEIHLKDKK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaaaaaagcagtcattccagcagcaggattagggacgagatttctgcctgcc
acaaaagcaatgcctaaagaaattcttccaatagtagacaagccaaccattcaatacata
gtagaagaagcagtagaatctggaattgaagatattctaattgttactggtaaagggaaa
agagctattgaagatcactttgactctgtaccagaacttgagctcaatctacgtgaaaaa
aacaaactagaattacttcatttaattgaagaaacaacaaatattaatctgcattttatt
cgtcaatcgaaacctaaaggacttggtgatgccatcttacaagcaagaggttttgttggt
aacgaaccatttatcgttatgttgggcgatgacattgtacaagcaaaaacaccatgtgca
aaacaactaatagatcaatatgaaaaaacacatagttcaatcattggagttcaaacggtt
cctcatgaagaaacttatcgttacggcattatcgatccaattgatgaatatagtaaaaat
ctgtacaatgtaaatggttttgtcgaaaagcctgatccaagtgcggcaccatctgacctt
gctattctgggtagatatctactaacacctcagatttttgactttctagaaacacaaaaa
cctggtgctggtggggaaatccaactaaccgacgcaatcaacagtttaaatgagattcag
cgtgtgttcgcttatgatttcgaaggagaacgttttgatgttggcgataaatttggtttt
attaagacgaccatgcaatttgctttaaaacatccggaaattaaagacgatgttgctctc
ttagtagatgaattatatgctgaaattcacttgaaggataaaaaataa

DBGET integrated database retrieval system