KEGG   Listeria monocytogenes HCC23: LMHCC_1639Help
Entry
LMHCC_1639        CDS       T00801                                 

Definition
peroxiredoxin Hyr1
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:lmh00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lmh00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1641796..1642275)
Genome map
AA seq 159 aa AA seqDB search
MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLEAMYKKLGGANFEILG
FPCNQFLRQDPGSDEEILEFCQMNYGVTFQMFSKIKVKGKDASPLYKYLTEQTGGKKVEW
NFAKFLIDENGEVVELFPSKMKPADFEDKVEALVAKVSK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtccatgatttttctgaaaaagcaatgaatggcaaagaaatagctttaagtgat
tataaaggcaaggtattacttatcgtgaatacagcgagcaaatgtggcttaacacctcag
cttgaaggcctagaagccatgtataaaaaattgggtggcgctaattttgaaattctcggt
ttcccatgtaaccagtttttacgtcaagatcctgggagtgatgaggaaattttagaattt
tgccaaatgaattatggtgtgacgttccaaatgttctctaaaattaaagtgaaaggcaaa
gacgccagcccgctttataaatatttaaccgaacaaactggtggtaaaaaagtagaatgg
aattttgcgaaattcttaattgatgaaaatggcgaagtggttgaacttttcccatcaaaa
atgaaaccagcagattttgaggataaagtggaagcacttgttgcgaaagtaagtaaataa

DBGET integrated database retrieval system