KEGG   Listeria monocytogenes HCC23: LMHCC_1639Help
Entry
LMHCC_1639        CDS       T00801                                 

Definition
peroxiredoxin Hyr1
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lmh  Listeria monocytogenes HCC23
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lmh00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    LMHCC_1639
  Metabolism of other amino acids
   00480 Glutathione metabolism
    LMHCC_1639
Enzymes [BR:lmh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     LMHCC_1639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1641796..1642275)
Genome map
AA seq 159 aa AA seqDB search
MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLEAMYKKLGGANFEILG
FPCNQFLRQDPGSDEEILEFCQMNYGVTFQMFSKIKVKGKDASPLYKYLTEQTGGKKVEW
NFAKFLIDENGEVVELFPSKMKPADFEDKVEALVAKVSK
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtccatgatttttctgaaaaagcaatgaatggcaaagaaatagctttaagtgat
tataaaggcaaggtattacttatcgtgaatacagcgagcaaatgtggcttaacacctcag
cttgaaggcctagaagccatgtataaaaaattgggtggcgctaattttgaaattctcggt
ttcccatgtaaccagtttttacgtcaagatcctgggagtgatgaggaaattttagaattt
tgccaaatgaattatggtgtgacgttccaaatgttctctaaaattaaagtgaaaggcaaa
gacgccagcccgctttataaatatttaaccgaacaaactggtggtaaaaaagtagaatgg
aattttgcgaaattcttaattgatgaaaatggcgaagtggttgaacttttcccatcaaaa
atgaaaccagcagattttgaggataaagtggaagcacttgttgcgaaagtaagtaaataa

DBGET integrated database retrieval system